DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and CG42709

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_648600.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:328 Identity:75/328 - (22%)
Similarity:137/328 - (41%) Gaps:60/328 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 VQGLRIVDFSHNHLRGLPDNLFYNGGMEKLDVSHNMMLKIPSSSLSSLAALTLCELHLSNNFIST 864
            ::..:.|..::.||..:|.::.....:  :|:|||::.::.....::|:...  |::|::|.||:
  Fly   100 LEDFKFVQCANAHLTHVPLDMPKTAAI--IDLSHNVIAELRPEDFANLSRAV--EINLNHNLISS 160

  Fly   865 IHSMDLSNKFRSLRYLDISYNYLLRIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMGLENSLIKL 929
            | ..|:......|:.|.::.|.|.:||...||...:|.:||||:|...:.:|.||:. :..|::.
  Fly   161 I-DKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLN-QPDLVEF 223

  Fly   930 GLENISLSTVPEIRLKYLREFRLGYNELPSIPQELAHNMSNLRMLDLSNNDLTNVPLMTQALPHL 994
            ...|.|.:.:||                     :...|||.|.:|.|:.||... .:.|:|...|
  Fly   224 SCVNCSWTELPE---------------------QTFQNMSGLEVLRLNKNDFKQ-QINTKAFSPL 266

  Fly   995 RRLMLSGNPITSLNNNSFDGVNEDLEMLDISNFRLHYFEYGCLD---SLPHLRSLKLTAYSHLEH 1056
            .:::....|  .|...:.:.:...|..:|..:| |:| :..|.:   ..|...||.......|:.
  Fly   267 TKIIKLKLP--ELEQQNIEELCSLLTSIDTISF-LNY-DISCYEFVLGTPFNGSLIYPTEPPLKG 327

  Fly  1057 FNIPHLLRHHYNIRQLWIEAPQP-------------FTRIVKKG--------SG----PTQEMQT 1096
            ...|.::....:..:.....|.|             .|.:||.|        ||    |..|.||
  Fly   328 ITNPPIVASITSTAKPVTATPAPPRSANRNRGKMDNSTELVKAGILSSETSTSGVSVEPPAESQT 392

  Fly  1097 LQL 1099
            .|:
  Fly   393 NQV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:404697
leucine-rich repeat 475..524 CDD:275380
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380
LRR <540..>834 CDD:443914 6/33 (18%)
leucine-rich repeat 549..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..730 CDD:275380
leucine-rich repeat 648..673 CDD:275380
leucine-rich repeat 674..705 CDD:275380
LRR <730..1081 CDD:443914 64/296 (22%)
leucine-rich repeat 731..754 CDD:275380
leucine-rich repeat 755..778 CDD:275380
leucine-rich repeat 779..802 CDD:275380 0/1 (0%)
leucine-rich repeat 803..823 CDD:275380 4/19 (21%)
leucine-rich repeat 852..876 CDD:275380 7/23 (30%)
leucine-rich repeat 877..900 CDD:275380 8/22 (36%)
leucine-rich repeat 901..925 CDD:275380 9/23 (39%)
leucine-rich repeat 926..946 CDD:275380 5/19 (26%)
leucine-rich repeat 947..970 CDD:275380 2/22 (9%)
leucine-rich repeat 971..993 CDD:275380 7/21 (33%)
leucine-rich repeat 994..1014 CDD:275380 3/19 (16%)
leucine-rich repeat 1019..1042 CDD:275380 6/25 (24%)
CG42709NP_648600.1 LRR <127..>300 CDD:443914 51/201 (25%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 7/25 (28%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 9/23 (39%)
leucine-rich repeat 220..243 CDD:275380 7/43 (16%)
leucine-rich repeat 244..268 CDD:275380 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.