DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and CG18480

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:157 Identity:47/157 - (29%)
Similarity:75/157 - (47%) Gaps:8/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 TSLQELDFSNNHISSMSDTSFHFLKNLRLLELHDNRIEQVLKGTFQGDIH---SKLEEISLRFNH 584
            |:::.||.|.|.|:::.|.||....:|..|.|..|.|.     |..||..   ::|..:.|.:|.
  Fly    74 TTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIH-----TLYGDAFVELTRLRYLDLSYNR 133

  Fly   585 LTSISQHTFFDLEALRKLHLDDNKIDKIERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLEI 649
            |..|.:|.......|..|:|:.||:..:.:...:....|..|:||.:::|.|..:....||:|..
  Fly   134 LEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQ 198

  Fly   650 LDMAFNQLPNFNFDYFDQVGTLSNLNV 676
            ||:|.|.|...:...|.....|::|||
  Fly   199 LDLAQNLLLTLSPGDFHAPRNLASLNV 225

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733 14/40 (35%)
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:404697 13/35 (37%)