DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and chp

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:XP_061510877.1 Gene:chp / 3289597 VectorBaseID:AGAMI1_000471 Length:1339 Species:Anopheles gambiae


Alignment Length:52 Identity:14/52 - (26%)
Similarity:24/52 - (46%) Gaps:12/52 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IAPLPVVMFV---VIGLLHVGAGHSNDF-------DAIKGCKQYNTEMGYND 43
            :|.|.|||.|   .:.|.::.:|..:|.       |:::|  :|.....|.|
Mosquito    21 VATLTVVMAVPMLCLYLQNIQSGLQDDLTFCKSRTDSLRG--EYTRLAAYRD 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:404697
leucine-rich repeat 475..524 CDD:275380
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380
LRR <540..>834 CDD:443914
leucine-rich repeat 549..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..730 CDD:275380
leucine-rich repeat 648..673 CDD:275380
leucine-rich repeat 674..705 CDD:275380
LRR <730..1081 CDD:443914
leucine-rich repeat 731..754 CDD:275380
leucine-rich repeat 755..778 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 803..823 CDD:275380
leucine-rich repeat 852..876 CDD:275380
leucine-rich repeat 877..900 CDD:275380
leucine-rich repeat 901..925 CDD:275380
leucine-rich repeat 926..946 CDD:275380
leucine-rich repeat 947..970 CDD:275380
leucine-rich repeat 971..993 CDD:275380
leucine-rich repeat 994..1014 CDD:275380
leucine-rich repeat 1019..1042 CDD:275380
chpXP_061510877.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.