DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and LOC1278814

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:XP_061500236.1 Gene:LOC1278814 / 1278814 VectorBaseID:AGAMI1_008860 Length:365 Species:Anopheles gambiae


Alignment Length:225 Identity:67/225 - (29%)
Similarity:104/225 - (46%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   853 CELHLSNNFISTIHSMDL---SNKFRSLRYLDISY----NYLLRIDDAVFATMPKLAVLDLSHNR 910
            |:||     .:|:| ||.   ::.|..:|.|...|    |:....::.:|    |..||.: ..|
Mosquito    41 CQLH-----NATVH-MDTDVQASVFPRVRQLGFIYGSIGNFTHTFNNQLF----KAGVLRV-FAR 94

  Fly   911 DLKVMDKSFMGLENSLIKLGLENISLSTVPEI--RLKYL-REFRLGYNELPSIPQELAH--NMSN 970
            ..:|   :.:.:.:::.:|.|.:..|.|| ||  |.:|: |..||..|:|.||    ||  :::.
Mosquito    95 GTRV---TTLTMPSTIEQLYLRDNGLRTV-EIDPRARYIVRYLRLQMNKLRSI----AHFEHLTQ 151

  Fly   971 LRMLDLSNNDLTNVPLMTQA-LPHLRRLMLSGNPITSLNNNSFDGVNEDLEMLDI-SNFRLHYFE 1033
            |..|:|.:|.:..|||.|.| :|.||:|:|.||.|.:|...........|..||: .||      
Mosquito   152 LHELNLCDNLIEAVPLDTFATMPALRQLILCGNHIKTLGTTPTVIQLPALTHLDLGGNF------ 210

  Fly  1034 YGCLDSLPHLRSLKLTAYSHLEHFNIPHLL 1063
               |.|||            ||.:.:|.|:
Mosquito   211 ---LASLP------------LERWQLPQLI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:404697
leucine-rich repeat 475..524 CDD:275380
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380
LRR <540..>834 CDD:443914
leucine-rich repeat 549..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..730 CDD:275380
leucine-rich repeat 648..673 CDD:275380
leucine-rich repeat 674..705 CDD:275380
LRR <730..1081 CDD:443914 67/225 (30%)
leucine-rich repeat 731..754 CDD:275380
leucine-rich repeat 755..778 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 803..823 CDD:275380
leucine-rich repeat 852..876 CDD:275380 8/25 (32%)
leucine-rich repeat 877..900 CDD:275380 5/26 (19%)
leucine-rich repeat 901..925 CDD:275380 4/23 (17%)
leucine-rich repeat 926..946 CDD:275380 8/21 (38%)
leucine-rich repeat 947..970 CDD:275380 9/25 (36%)
leucine-rich repeat 971..993 CDD:275380 9/22 (41%)
leucine-rich repeat 994..1014 CDD:275380 8/19 (42%)
leucine-rich repeat 1019..1042 CDD:275380 8/23 (35%)
LOC1278814XP_061500236.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.