DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and lrrtm2

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_001338621.1 Gene:lrrtm2 / 100538061 ZFINID:ZDB-GENE-080327-8 Length:542 Species:Danio rerio


Alignment Length:354 Identity:98/354 - (27%)
Similarity:152/354 - (42%) Gaps:57/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 VGPEDFKDFGVELEDLQITRASLSGIQSHAFKHVRGLKRLDFSENGISSIENDAFHEIGHSLISL 503
            :.|.|..|.|.  ..|.:...|:|.:.|..|.....|..|....|.|:::..|||..: :.|..|
Zfish    53 LAPPDGVDKGA--LGLSLRHNSISELSSDQFFGFTQLTWLHLDHNQITTVHEDAFQGL-YKLKDL 114

  Fly   504 KMSHGYSGSALPAEPLRHLTSLQELDFSNNHISSMSDTSFHFLKNLRLLELHDNRIEQVLKGTFQ 568
            .:|.... :.||.....||.:||.||.|.|.::::....||.|:.|::|.|..|.:.......| 
Zfish   115 NLSSNRI-TKLPNTTFIHLINLQILDLSFNQMTALEPELFHGLRKLQILHLRSNSLRTTPVRAF- 177

  Fly   569 GDIHSKLEEISLRFNHLTSISQHTFFDLEALRKLHLDDNKIDKIERRAFMNLDELEYLSLRGNKI 633
            .|..| ||.:.|..|.|.|::::.|..|..||:|||:.|.:.||....|..|..|::|.|:.|||
Zfish   178 WDCRS-LEYLGLSNNRLRSLARNGFAGLIKLRELHLEHNHLTKINLAHFPRLVALQFLYLQWNKI 241

  Fly   634 NNLAD------------------------ESFQNLPKLEILDMAFNQLPNFNFDYFDQVGTLSNL 674
            |||..                        |.|:.||.|:||.:..|:|.|.:....|...:|:.:
Zfish   242 NNLTSTMEWKWTTLEKLDLTGNEIRVLIPEVFETLPSLKILLLDNNKLSNLDSQTMDMWKSLNVI 306

  Fly   675 NVNVSHNQIRQLMYN-----SSWSGRNEHGGM-----YHSNIKILD------LSHNNISIIHPGY 723
            .::.:..:..:.:.|     |::.||.||..:     |....:|||      |..|        :
Zfish   307 GLSSNLWECTKRICNLATWLSTFKGRWEHSILCYSPEYAQGEEILDAVYGFQLCQN--------F 363

  Fly   724 FRPAEISLTHLHLGYNSLMNTTRDVFGNM 752
            ..|..::.|....   .|.:.|..:||||
Zfish   364 SAPVVLTSTSTEA---MLPDITSSLFGNM 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733 36/124 (29%)
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378 4/10 (40%)
leucine-rich repeat 451..474 CDD:275380 5/22 (23%)
LRR_8 473..559 CDD:404697 27/85 (32%)
leucine-rich repeat 475..524 CDD:275380 14/48 (29%)
leucine-rich repeat 500..519 CDD:275380 5/18 (28%)
leucine-rich repeat 525..548 CDD:275380 9/22 (41%)
LRR <540..>834 CDD:443914 69/253 (27%)
leucine-rich repeat 549..574 CDD:275380 6/24 (25%)
leucine-rich repeat 575..598 CDD:275380 8/22 (36%)
leucine-rich repeat 599..622 CDD:275380 10/22 (45%)
leucine-rich repeat 623..646 CDD:275380 12/46 (26%)
leucine-rich repeat 647..730 CDD:275380 21/98 (21%)
leucine-rich repeat 648..673 CDD:275380 7/24 (29%)
leucine-rich repeat 674..705 CDD:275380 7/40 (18%)
LRR <730..1081 CDD:443914 7/23 (30%)
leucine-rich repeat 731..754 CDD:275380 7/22 (32%)
leucine-rich repeat 755..778 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 803..823 CDD:275380
leucine-rich repeat 852..876 CDD:275380
leucine-rich repeat 877..900 CDD:275380
leucine-rich repeat 901..925 CDD:275380
leucine-rich repeat 926..946 CDD:275380
leucine-rich repeat 947..970 CDD:275380
leucine-rich repeat 971..993 CDD:275380
leucine-rich repeat 994..1014 CDD:275380
leucine-rich repeat 1019..1042 CDD:275380
lrrtm2NP_001338621.1 LRRNT 34..>59 CDD:214470 2/5 (40%)
LRR <66..349 CDD:443914 81/286 (28%)
leucine-rich repeat 66..86 CDD:275380 5/19 (26%)
leucine-rich repeat 87..110 CDD:275380 7/23 (30%)
leucine-rich repeat 111..134 CDD:275380 7/23 (30%)
leucine-rich repeat 135..158 CDD:275380 9/22 (41%)
leucine-rich repeat 159..182 CDD:275380 6/23 (26%)
leucine-rich repeat 183..206 CDD:275380 8/22 (36%)
leucine-rich repeat 207..230 CDD:275380 10/22 (45%)
leucine-rich repeat 231..254 CDD:275380 9/22 (41%)
leucine-rich repeat 255..278 CDD:275380 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.