DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stops and Asb17

DIOPT Version :9

Sequence 1:NP_733416.2 Gene:stops / 43683 FlyBaseID:FBgn0086704 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_080034.2 Gene:Asb17 / 66772 MGIID:1914022 Length:295 Species:Mus musculus


Alignment Length:309 Identity:64/309 - (20%)
Similarity:119/309 - (38%) Gaps:106/309 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 TDEVAAIAVTAAMRYHRMAKEQN---GQVCLMGKYHNILYIGLRTCWDWGVRDSEVVVKLLVAIY 186
            ||.:|.:..:.    ||.....|   .::|:    :.|||      |.:..:.:...|:||:   
Mouse    68 TDYIAFVEKSG----HRFELNFNLEFTEICV----NTILY------WVFARKGNPDFVELLL--- 115

  Fly   187 ECEKTYERIFLGALFGPHAPHFIAGWRSDFQDQHENVRAMVYFLKHATREQLTLPVWIPRFEQER 251
              :||.:.:                     ||:..:: |:::        :...||:.|.     
Mouse   116 --KKTKDYV---------------------QDRSCSL-ALIW--------RTFTPVYCPS----- 143

  Fly   252 QLRFIDVPIESCGKSSPLRIALQANAPELLLILLRYGAAPQPPDGGASVIIALL----------D 306
                   |:...   :||....|.....:|.|||:||...:..:....|:..||          .
Mouse   144 -------PLSGI---TPLLYVAQTRQSNILKILLQYGILEREKNPINIVLTILLYPSRVRIMVDH 198

  Fly   307 KLIEDGRNYSFELVMCLKIL----LRNV-VMIEMPFKPLLYAARREMFFD-----RYGRLLMDKI 361
            :||:...:....|::|.::|    :|.: ..:.:..:|::     :.:.|     ||        
Mouse   199 ELIDIQEDAKTCLMLCSRVLSTISVREIETQLSLGRRPII-----QNWLDYIPPTRY-------- 250

  Fly   362 IGKEQVYGVPSLRHLCRCCIRDVMRMHNQLPSGIDTLRLPKRLQRYIDL 410
              |:..    .|.||||..||..:..:|.||:||.:|.:|.|||.:::|
Mouse   251 --KDPC----ELVHLCRITIRTQLLANNMLPNGIFSLLIPTRLQNFLNL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stopsNP_733416.2 SOCS_box 369..408 CDD:462192 17/38 (45%)
Asb17NP_080034.2 ANK 146..176 9/32 (28%)
SOCS_ASB_like 251..294 CDD:239686 19/47 (40%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.