DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11318 and Adgrg2

Sequence 1:NP_651842.3 Gene:CG11318 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster
Sequence 2:XP_006528869.1 Gene:Adgrg2 MGIID:2446854 Length:1092 Species:Mus musculus

Alignment Length:655 Identity:161/656 (25%)
Similarity:265/656 (40%) Gaps:131/656 (20%)


  Fly   229 LSAQLNATNSLLSQFESYMDALPEQLVPKDRCGKVVAKPTSDEAETATTGVETYNFSDIGVQ--- 290
            ||..|:...|.:....:...::|.:||       .::.|..:      |.|.|...||:..|   
Mouse   400 LSHTLSPVQSSIPSPTTPAPSVPTELV-------TISTPPGE------TVVNTSTVSDLEAQVSQ 451

  Fly   291 ---ALITGNISVFFANPECDRITGL----AIFSAPGDQR---KTSASGFWYRF------------ 333
               ||..|::....|....:|::.|    ....||..||   ...|.|....|            
Mouse   452 MEKALSLGSLEPNLAGEMVNRVSKLLHSPPALLAPLAQRLLKVVDAIGLQLNFSSTTISLTSPSL 516

  Fly   334 ----IR-----FSEDLAKVKEESNLET------------AAFLPENLWRQVKSRG---ATYLIFK 374
                ||     |:......::.:||:.            |..||.:|...:.:..   |:.:.|.
Mouse   517 ALAVIRVNASNFNTTTFAAQDPTNLQVSLETPPPENSIGAITLPSSLMNNLPANDVELASRIQFN 581

  Fly   375 VYAHDALFVETSLQRTRKPRSKVISISIPGLRSNYLSLPLPFLLRNENLRNPDSKAFSIGSGCGY 439
            .:...|||.:.||:.... .|.|||.|:..:....|:..:...|::.| .:||.....    |.:
Mouse   582 FFETPALFQDPSLENLTL-ISYVISSSVTNMTIKNLTRNVTVALKHIN-PSPDDLTVK----CVF 640

  Fly   440 WNY---ET----------WSTEGVSTESSSDLLKDAIIECHTNHLTQFAFLVGGSYRANDLGEEI 491
            |:.   :|          ||::|.|.:...  :.:.|..|  :|||.|..|:       ||....
Mouse   641 WDLGRNDTALVPTGGKGGWSSDGCSVKDKR--MNETICTC--SHLTSFGILL-------DLSRTS 694

  Fly   492 LITPINEKVLDIISIVGCSLSLLGILGIFLTAALFKSWRSQASTKVLLHLCLAMCLQMMLFVFLN 556
            | .|.....|..|:.:||.||.:.:....:|...|:..|....:|:|:.||.|:.|..::|:.  
Mouse   695 L-PPSQMMALTFITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLIFLL-- 756

  Fly   557 TDDVSEALVVNGNTVR-CVALGAAMQYSILVLFSWMLIIAFLQFQRYVTVIG--IERPPRYILKA 618
                 ::.:...||.. |:|:...:.|.:||.|:||.:.||..:...|.|..  |.   :||||.
Mouse   757 -----DSWIALYNTRGFCIAVAVFLHYFLLVSFTWMGLEAFHMYLALVKVFNTYIR---KYILKF 813

  Fly   619 AIVAWLLPLVPTLLVALIDPDSY-VPSAAQL--STDTGICYPSGYGLIFGVVLPVT------LIT 674
            .||.|.:|.|...:|..|.||:| :.|..:.  .|....|:.:.     .||..:|      :|.
Mouse   814 CIVGWGIPAVVVSIVLTISPDNYGIGSYGKFPNGTPDDFCWINS-----NVVFYITVVGYFCVIF 873

  Fly   675 VCNLVIFVYVFYSISHSLSQSIHKNEKKMVVKQIRLSIMLFFLLGLTWIFGIFAFMQAGVAFSYL 739
            :.|:.:|:.|...:.....:.....::|..::.:|....|.||||:||.|..||:....|.|.||
Mouse   874 LLNVSMFIVVLVQLCRIKKKKQLGAQRKTSIQDLRSIAGLTFLLGITWGFAFFAWGPVNVTFMYL 938

  Fly   740 FCITATMQGFVMFIYFVLLDSTNRRLWVGLICPTKMEL-----------DVQKRTTELQSMTTSS 793
            |.|..|:|||.:||::.......|:.|...:|..|:.|           :..|:.|..|.:::||
Mouse   939 FAIFNTLQGFFIFIFYCAAKENVRKQWRRYLCCGKLRLAENSDWSKTATNGLKKQTVNQGVSSSS 1003

  Fly   794 TNYNS 798
            .:..|
Mouse  1004 NSLQS 1008

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11318NP_651842.3 GPS 437..475 CDD:280071 13/51 (25%)
7tm_4 500..750 CDD:304433 77/262 (29%)
Adgrg2XP_006528869.1 ATF7IP_BD <298..449 CDD:293393 14/62 (23%)
GPS 638..687 CDD:280071 13/53 (25%)
7tm_4 700..950 CDD:304433 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4193
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4824
Isobase 1 0.950 0 Normalized mean entropy S7779
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135426
Panther 1 1.100 LDO PTHR12011
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.