DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dco and vrk1

Sequence 1:NP_001263132.1 Gene:dco FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_998550.1 Gene:vrk1 ZFINID:ZDB-GENE-040426-2709 Length:425 Species:Danio rerio

Alignment Length:381 Identity:103/382 (27%)
Similarity:171/382 (45%) Gaps:69/382 (18%)


  Fly     8 KYRLGRKIGSGSFGDIYLGTTINTGEEVA-----IKLECIRTKHPQLHIESKFY----------- 56
            |::||..:|.|.||.:||....::|...|     ||:|  .:.:..|..|.|||           
Zfish    37 KWKLGSAVGQGGFGLLYLANEDSSGPVTADAPYVIKVE--PSDNGPLFSELKFYMRAAKPDLIGA 99

  Fly    57 ----KTMQGGIGIPRIIWCG---SEGD-YNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMI 113
                |.|: .:|:|:....|   ..|. |..|||:..|..|:.||....::||.|.||.|..:::
Zfish   100 WMKSKKME-YLGVPKYWGSGFHEKNGKRYRFMVMDRFGTDLQKLFEGNGKKFSRKLVLQLGLRLL 163

  Fly   114 SRIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIP--YRENKNL--T 174
            ..::|||..:::|.|||..|.|:.. ...|.|:::|:|||.::    :.:.:|  |:|:...  .
Zfish   164 DILEYIHDHEYVHADIKASNLLLSY-TNPNQVFLVDYGLAYRY----APEGVPKEYKEDPKRCHD 223

  Fly   175 GTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANKRQK--YERISEKKLSTSI 237
            ||..:.||:.|.|:..|||.|||.:||.::.:....|||:     :|.|.  |.|.|:.:...:|
Zfish   224 GTIEFTSIDAHKGVSPSRRADLEIMGYCMIQWLCSRLPWE-----DKLQDPLYVRDSKLRCRDNI 283

  Fly   238 VVLCK------GFPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDW------ 290
            ....|      ..|:|...::...:.:.:..||||..||.:.:.....:|.|.|...|:      
Zfish   284 DEFLKSCFASGNIPAEMGKFMQEVKVLGYTDRPDYDKLRGILQQGLKSIGSTDDKKLDFGVATNS 348

  Fly   291 -NLLKFGGPRNPQAIQQAQDGADGQAGHDAVAAAAAVAAAAAASSHQQQQHKVNAA 345
             :|.....|:..:|.::.|             :|....:..|......|:.:||.|
Zfish   349 TSLPSVKTPKRKKAEEKGQ-------------SADETDSTPAKKRRAPQKKEVNGA 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 90/310 (29%)
S_TKc 9..264 CDD:214567 83/291 (29%)
vrk1NP_998550.1 PKc_like 27..327 CDD:304357 89/303 (29%)
SPS1 37..>265 CDD:223589 74/241 (31%)
GAGA_bind <373..>424 CDD:283799 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.