DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dco and C08F8.6

Sequence 1:NP_001263132.1 Gene:dco FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_502093.1 Gene:C08F8.6 WormBaseID:WBGene00007448 Length:380 Species:Caenorhabditis elegans

Alignment Length:310 Identity:90/311 (29%)
Similarity:157/311 (50%) Gaps:26/311 (8%)


  Fly     1 MELRVG---NKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFYKTMQ-- 60
            ::|.||   .|:::.:|:|.|:||.:|..:. ..|:..|:|:|....|...|.:|......::  
 Worm     5 IQLSVGTKVKKWQIDKKLGEGAFGAVYKCSN-PKGDLFALKVEGKDEKIQLLKMEVYVLNELKKA 68

  Fly    61 GGIGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFC-SRRFSLKTVLLLADQMISRIDYIHSRDF 124
            ||.....|...|...::|.:||..:|.||.||.... :::||:.|.:.:|.|.:..::.:|:..:
 Worm    69 GGRHFCNIEDKGQVDNFNYVVMTFVGLSLADLRAISPTKKFSMGTAISIARQSLEALEDMHNIGY 133

  Fly   125 IHRDIKPDNFLMGLGKKGNL--VYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYASINTHLG 187
            :|||:||.|:.:|..:...|  ||::|||:|:||.........| |......||.:||.::.|.|
 Worm   134 LHRDVKPGNYTIGRAEVNELRKVYVLDFGMARKFAHEDGTIKKP-RNVAGFRGTVKYAPVSCHAG 197

  Fly   188 IEQSRRDDLESLGYVLMYFNLGALPWQGL----KAANKRQKYER--ISEKKLSTSIVVLCKGFPS 246
            .|..|:||.|:..|:::....|:|||:.:    ...|:::...|  |.:||       :..|.|.
 Worm   198 RELCRQDDCETWLYMVVELTKGSLPWRNMTEIQDVGNEKRAIRRDPIVKKK-------MFGGCPR 255

  Fly   247 EFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDW--NLLK 294
            |:::.|....:..|...|:|..:..|.|......|.| :|.:||  :|:|
 Worm   256 EYLDILEAIDKGQFFDEPNYERIYYLLREAMKNTGST-EYPYDWEQSLMK 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 81/285 (28%)
S_TKc 9..264 CDD:214567 75/266 (28%)
C08F8.6NP_502093.1 STKc_TTBK 15..283 CDD:270919 79/277 (29%)
S_TKc 16..264 CDD:214567 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.