DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dco and spe-6

Sequence 1:NP_001263132.1 Gene:dco FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_499482.1 Gene:spe-6 WormBaseID:WBGene00004960 Length:379 Species:Caenorhabditis elegans

Alignment Length:338 Identity:98/339 (29%)
Similarity:152/339 (45%) Gaps:39/339 (12%)


  Fly     7 NKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIR---TKHPQLHIESKFYKTMQGGIGIPRI 68
            :|:::.|.|.||.|.|:|:.....|.|:.|:|  |.|   ...|.|.::.......:|..|.|..
 Worm    24 HKWKVLRNIYSGPFSDVYVVADTVTNEKYAMK--CERQEGNSRPVLKLDVMVLMATKGLRGFPNF 86

  Fly    69 IWCGSEGDYNVMVMELLGPSLEDLFNF-CSRRFSLKTVLLLADQMISRIDYIHSRDFIHRDIKPD 132
            :..|....|...:|:|:||.|..|... ..|:|||.|.|.:..|.:.|::.:|:..::.||:|..
 Worm    87 VAAGRTDVYRYCIMQLVGPDLGRLRRTRPERKFSLPTALQILGQTLRRLEDLHNCGWLCRDVKAP 151

  Fly   133 NFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYASINTHLGIEQSRRDDLE 197
            ||.:|:|:..:.|||:|||.|:||.|... |.||.|....|.||.:|.:::.|...:|..|||||
 Worm   152 NFCIGVGENESTVYILDFGFARKFVDKEG-KIIPPRTAAALMGTFQYCAVSAHSHKDQCARDDLE 215

  Fly   198 SLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLSTSIVVL----CKGFPSEFVNYLNFCRQM 258
            |..|:.:....|.|||..:   :..:.:::|.|.|::.....|    .:|.|.:|...|....|.
 Worm   216 SWFYMGIELLKGPLPWANI---DGHKNHKQIGEAKVAIRSEPLRSEFFEGVPKQFNEILTILDQT 277

  Fly   259 HFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGGPRNPQAIQQAQDGADGQAGHDAVAAA 323
            .:..||:|..|..|..........|.....||        :|.:.:||                 
 Worm   278 SYFDRPNYKKLGDLLSQAATEHQVTLKEPLDW--------QNNERMQQ----------------- 317

  Fly   324 AAVAAAAAASSHQ 336
            .|:.......|||
 Worm   318 KAIFVGELGESHQ 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 88/282 (31%)
S_TKc 9..264 CDD:214567 83/263 (32%)
spe-6NP_499482.1 STKc_TTBK 25..293 CDD:270919 88/274 (32%)
S_TKc 26..271 CDD:214567 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S280
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.