DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp4 and phu

Sequence 1:NP_524601.2 Gene:Alp4 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_649897.4 Gene:phu FlyBaseID:FBgn0043791 Length:546 Species:Drosophila melanogaster

Alignment Length:585 Identity:221/586 (38%)
Similarity:312/586 (53%) Gaps:74/586 (13%)


  Fly     7 LGFLLGSLVAFSWAGVTTQPP-----PLIRTLSAGGD-IG--------PQ--FDVGKTKEPEDAE 55
            |.|.||..|..| .|.::...     |:...:..|.: ||        ||  ||..:::| ..||
  Fly     5 LFFFLGLSVLVS-GGESSHDAERRMHPVFSLMGTGSNPIGGGRYKRAMPQIVFDAVRSEE-RYAE 67

  Fly    56 FWHNVGLRQLEKTIKQAQRVKEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQYLKHGYGEEET 120
            :|..:..:.|::.::...|:.    .:.|||:::||||||.|.||:|||:|.|       |||:.
  Fly    68 YWQGLAAQTLDQQLESKLRLN----TQLARNVMLFIGDGMSIPTITAGRVYLG-------GEEKQ 121

  Fly   121 LVFDDFPNTGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDATRSKKNGQ-----QGRVQS 180
            ..|:.||..|::|||..:.||.|||.||||...|.|.:||.||:.|....|:.|     ...|.|
  Fly   122 FAFEQFPYVGLSKTYCANMQVADSACTATAYLGGVKANYGTIGVSAAVQFKDCQAQAQAAHHVSS 186

  Fly   181 VMEWAQKEGKRTGVVTTTRITHATPAATYAHIYDRDWECDTEVPAES--VGFHVDIARQLVENAP 243
            :..||||:|..||:||||.:|||:||..|||:.:|:||.|.||..::  .....|.|.||:.:..
  Fly   187 IAAWAQKQGMATGLVTTTSVTHASPAGVYAHLANRNWENDAEVVGDNGDPDLCPDAAAQLINSPV 251

  Fly   244 GNRFNVILGGGMS---PMGILNASEVKTTIFEGPTETICTRGDNRNLPAEWLAHHANDTVPPALV 305
            |.:.|||:|||..   |.|:.::|....           .|.|.|||..||...|.|..   ..|
  Fly   252 GQKLNVIMGGGRENFLPKGVTDSSGAPG-----------RRLDGRNLIDEWKNQHTNSA---QYV 302

  Fly   306 HNRKDLLNVNVKKVDHLMGLFRNNHITYSI-AREAGEPSLQEMTETALGILERGDESNGFVLLVE 369
            .||::|||:: .....::|||...|:.|.: |..|.:|:|:||.::|:.||||.....|:.|.||
  Fly   303 ENRRELLNLS-NHTSRVLGLFAPYHMAYHLDASPAEQPTLEEMVQSAMEILERQSAGRGYFLFVE 366

  Fly   370 GGRIDQGHHMNYARAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGYALRGADILG 434
            |||||.|||...|..|:.|..|||.|::.|.::|..|:|||:|::||||.::..||:.|..||.|
  Fly   367 GGRIDHGHHDTLALRAIDETAEFDKAVRFARSHTSTDDTLIVVSSDHSHTMSLAGYSSRKNDIFG 431

  Fly   435 TANSHEKNDPMFYETISYANGPGYWDHLANDS---RPQNSSNMWMPLKHFTAEERAAPTYRHLAT 496
            ..:.....|.:.|.|:||||||||..:...:.   |.:|...:.|..|.|...          :|
  Fly   432 INDGQLAADDLPYATLSYANGPGYDSNYLREGGAVRRKNLRAINMKNKDFMFP----------ST 486

  Fly   497 VPRKDETHGGEDVAVFAYGPGSSLIRGVFEQNYLAYVMSYAGCLGPAKDFDDSCEDHKDGQKDRP 561
            ||.:.|||||:||||||.||.:.|..|||||:::.:.:.||.||...    :.|.|  .|...||
  Fly   487 VPLESETHGGDDVAVFASGPYAQLFTGVFEQHFIPHALGYASCLSDR----NMCVD--GGVARRP 545

  Fly   562  561
              Fly   546  545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 193/488 (40%)
alkPPc 85..541 CDD:214515 194/470 (41%)
phuNP_649897.4 PhoA 71..524 CDD:224699 193/489 (39%)
alkPPc 93..530 CDD:214515 193/469 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455916
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.