DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp4 and Alp10

Sequence 1:NP_524601.2 Gene:Alp4 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster

Alignment Length:508 Identity:192/509 (38%)
Similarity:278/509 (55%) Gaps:45/509 (9%)


  Fly    50 EPEDAEFWHNVGLRQLEKTIKQAQRVKEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQYLKHG 114
            |..|..|||:.....|...:...:::.|:    :|:|:|:|:||||.:.||:|.|.:.|.     
  Fly    45 EELDTRFWHDKAQSILADKLAGHKKLNEN----RAKNVILFLGDGMSVHTIAATRAFMGD----- 100

  Fly   115 YGEEETLVFDDFPNTGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDATRSKKN---GQQG 176
              ..:.:.|:.||..|::|||.|:::.||||.||||..:|.|.:||.||::|...:.:   ....
  Fly   101 --SNKQVFFEKFPYLGLSKTYAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGDCVTNSSS 163

  Fly   177 RVQSVMEWAQKEGKRTGVVTTTRITHATPAATYAHIYDRDWECDTEVPAE--SVGFHVDIARQLV 239
            .|||:.:|||:.||..|:|||.|:|||:||..|||:.:|:||.|.|:.:.  |...:.|||||||
  Fly   164 HVQSIGQWAQEAGKWAGLVTTARVTHASPAGVYAHVSERNWEHDGEIISSKCSPDVNTDIARQLV 228

  Fly   240 ENAPGNRFNVILGGGMSPMGILNASEVKTTIFEGPTETICTRGDNRNLPAEWLAHHANDTVPPAL 304
            |...|....||:|||.|  ...:.|:...|...|      .|.|.|:|.::|.............
  Fly   229 EWPVGQELRVIMGGGRS--YFRDQSQHDETGVSG------LRTDGRDLISDWREIKKQQGAEGKY 285

  Fly   305 VHNRKDLLNVNVKKVDHLMGLFRNNHITYSIAR-----EAGEPSLQEMTETALGILERGDESNGF 364
            |.:.|.|...::.|.|:|:|||..:|:.|...|     |..||||.:|||.|:.:|.:.:|  |:
  Fly   286 VWSLKGLKETDISKTDYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEE--GY 348

  Fly   365 VLLVEGGRIDQGHHMNYARAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGYALRG 429
            .|.||.||||..||...|..||.:..||..|::.|...||.::|||:||:||||.::.|||..|.
  Fly   349 FLFVESGRIDMAHHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYRR 413

  Fly   430 ADILGTANSHEKNDPMFYETISYANGPGYWD-HLANDSRPQNSSNMWMPLKHFTAEERAAPTYRH 493
            .:||..| .:..:|.:.:..:|||||||:.| :...|.|        :.|.|   .:..:..:..
  Fly   414 QNILSLA-PNLADDELPFTILSYANGPGFDDTYSTKDGR--------IDLSH---ADTTSAEFEF 466

  Fly   494 LATVPRKDETHGGEDVAVFAYGPGSSLIRGVFEQNYLAYVMSYAGCLGP-AKD 545
            .||||...||||.|||.|||.||...|..|.:||:.:..:|:||..:|| |||
  Fly   467 QATVPLSSETHGAEDVGVFASGPFEHLFTGNYEQSAIPAMMAYAANIGPFAKD 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 179/485 (37%)
alkPPc 85..541 CDD:214515 179/467 (38%)
Alp10NP_647976.1 PhoA 56..510 CDD:224699 181/487 (37%)
ALP_like 75..511 CDD:304875 180/465 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455893
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.