DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp4 and Alp7

Sequence 1:NP_524601.2 Gene:Alp4 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_611653.1 Gene:Alp7 FlyBaseID:FBgn0034710 Length:543 Species:Drosophila melanogaster

Alignment Length:584 Identity:214/585 (37%)
Similarity:314/585 (54%) Gaps:73/585 (12%)


  Fly     1 MHCLVILGFLLGSLVAFSWAGVTTQPPPLIRTLSAGGDIGPQFDVGKTKE--------------- 50
            |...|.:..:|.:|||.|.|.....|....:....||.:    ...||:|               
  Fly     1 MKTFVAISLVLCTLVATSLAASIDMPEIHNQFQLVGGSV----STAKTREGNLIDPNAMAKGKPG 61

  Fly    51 PED---AEFWHNVGLRQLEKTIKQAQRVKEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQYLK 112
            ||:   |:||:::...::.|.::|.|..|     :||:|:|:|:||||.:||::|.||:||| ||
  Fly    62 PEEEKNAQFWYDLAYEEIAKRLEQPQLDK-----RKAKNVILFLGDGMSLSTVAAARIHKGQ-LK 120

  Fly   113 HGYGEEETLVFDDFPNTGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDATRSKKN--GQQ 175
            ...|||::|.|:.||.||:::||..:.||||||.||||...|.||:..|:|:.|..|..|  |.:
  Fly   121 GNTGEEDSLSFEKFPYTGLSRTYCSNAQVPDSACTATAYLCGVKTNIVALGITAAVSFNNCSGSE 185

  Fly   176 ---GRVQSVMEWAQKEGKRTGVVTTTRITHATPAATYAHIYDRDWECDTEVPAESVGFH-----V 232
               .:|.|:..|||..||.||:||||.:|||:|:..||...:|.:|.||::.....|.:     .
  Fly   186 DPANQVDSIAAWAQAAGKATGIVTTTTLTHASPSGAYAKTTNRFFESDTDILTYGEGQNDPATCT 250

  Fly   233 DIARQLVENAPGNRFNVILGGGMSPMGILNASEVKTTIFEGPTETICTRGDNRNLPAEWLAHHAN 297
            |||.||:..|||..|:|:||||:...       :..||.: |......|.|..||.:.|...|..
  Fly   251 DIATQLITQAPGKNFDVMLGGGIGKF-------LPNTITD-PFNKKGERSDGVNLLSRWQGLHPG 307

  Fly   298 DTVPPALVHNRKDLLNVNVKKVDHLMGLFRNNHITYS-IAREAGEPSLQEMTETALGILERGDES 361
            .    .|.:||..||:|||.|:.:|:|.||:..:::: :|....||:|.|||..|:.::.:.|  
  Fly   308 G----VLAYNRNQLLSVNVSKITNLIGTFRSGVMSFNKMADPKEEPTLAEMTRKAIEVVSKRD-- 366

  Fly   362 NGFVLLVEGGRIDQGHHMNYARAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGYA 426
            .|:.|.||||.||.|:|.|....:|.|..:|:.|:|.|::.|||:||||:||:||:|.:|.:||.
  Fly   367 GGYFLFVEGGLIDYGNHFNSPTYSLSETLQFEQAVQEALDITDPEETLIVVTSDHAHPLTISGYP 431

  Fly   427 LRGADILGTANSHEKNDPMFYETISYANGPG-YWDHLAN--DSRPQNSSNMWMPLKHFTAEERAA 488
            .||..|||........:.:.|.|::||.|.. |.|....  |...|           ..||:...
  Fly   432 GRGTPILGLNQDDTDVNGVKYATLNYAVGTNQYLDEHGQRIDLTDQ-----------IGAEDFIH 485

  Fly   489 PTYRHLATVPRKDETHGGEDVAVFAYGPGSSLIRGVFEQNYLAYVMSYAGCLGPAKDFDDSCED 552
            |:|.| .|:    ..|.|:||.:||.||.|.|..||.:|:.:.::|:||.|:|......|: ||
  Fly   486 PSYIH-GTI----GVHAGDDVGIFATGPQSHLFTGVMQQSTIPHLMAYASCIGNGPTLCDN-ED 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 187/488 (38%)
alkPPc 85..541 CDD:214515 185/470 (39%)
Alp7NP_611653.1 ALP_like 94..533 CDD:304875 185/470 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455933
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.