DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp4 and Alpg

Sequence 1:NP_524601.2 Gene:Alp4 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_017452393.1 Gene:Alpg RGDID:1565100 Length:493 Species:Rattus norvegicus

Alignment Length:510 Identity:193/511 (38%)
Similarity:256/511 (50%) Gaps:94/511 (18%)


  Fly    50 EPEDAEFWHNVGLRQLEKTIKQAQRVKEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQYLKHG 114
            |.|:..||:    ::.::.:..|:::|  ..:..|:|:|||:|||||:.|::|.||.|||...| 
  Rat    26 EEENPAFWN----QKAKEALDVAKKLK--PIRTSAKNLIIFLGDGMGVPTVTATRILKGQLGGH- 83

  Fly   115 YGEEETLVFDDFPNTGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDATR--SKKNGQQG- 176
            .|.|..|..|.||.|.::||||||:|||||||||||...|.|.:|..||:.|..  ::.|...| 
  Rat    84 LGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGN 148

  Fly   177 RVQSVMEWAQKEGKRTGVVTTTRITHATPAATYAHIYDRDWECDTEVPAESV--GFHVDIARQLV 239
            .|.|||..|:|.||..||||||.:.||:||.||||..:.||..|..:...::  |.. |||.||:
  Rat   149 EVFSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNCDWYSDAHMATAALQEGCK-DIAMQLI 212

  Fly   240 ENAPGNRFNVILGGG---MSPMGILNASEVKTTIFEGPTETICTRGDNRNLPAEWLAHHANDTVP 301
            .|..   .:||||||   |.|.|..:..      :.|......||.|.:||..:|||.|..    
  Rat   213 SNMD---IDVILGGGRKFMFPKGTPDPE------YSGNRAQSGTRLDGQNLVQKWLAKHQG---- 264

  Fly   302 PALVHNRKDLLNVNV-KKVDHLMGLFRNNHITYSIARE-AGEPSLQEMTETALGILERGDESNGF 364
            ...|.||.:|:..:. ..|.||||||..|.:.|.|.|: ..:|||.||||.|:.:|.|..:  ||
  Rat   265 ARYVWNRTELIQASQDSAVTHLMGLFEPNDMKYDIYRDPTQDPSLAEMTEVAVHLLSRNPK--GF 327

  Fly   365 VLLVEGGRIDQGHHMNYA----RAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGY 425
            .|.|||         .::    |..|...:...|.:.|.:                  ..:||  
  Rat   328 YLFVEG---------EWSCLAERLPLPFPFPPPLPLPAGL------------------GASFN-- 363

  Fly   426 ALRGADILGTANSHEKNDPMFYETISYANGPGYWDHLANDSRPQNSSNMWMPLKHFTAEERAAPT 490
            ||.|..               :.:|.|.|||||  .|...:||.           .|.:|...|.
  Rat   364 ALDGRP---------------FTSILYGNGPGY--KLEKGTRPD-----------VTDKESRDPK 400

  Fly   491 YRHLATVPRKDETHGGEDVAVFAYGPGSSLIRGVFEQNYLAYVMSYAGCLGPAKD 545
            ||..|.||...|||.|||||:||.||.:.|:.||.||||:|:||::||||.|..|
  Rat   401 YRQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTD 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 182/488 (37%)
alkPPc 85..541 CDD:214515 184/470 (39%)
AlpgXP_017452393.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21913362
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.