DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp4 and Alp6

Sequence 1:NP_524601.2 Gene:Alp4 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_610496.1 Gene:Alp6 FlyBaseID:FBgn0033423 Length:515 Species:Drosophila melanogaster

Alignment Length:532 Identity:203/533 (38%)
Similarity:283/533 (53%) Gaps:75/533 (14%)


  Fly    40 GPQFDVG----KTKEPEDAEFWHNVGLRQLEKTIKQAQRVKEDSYQKKARNIIIFIGDGMGISTI 100
            |..||..    |..|.:..::|  |...|.:...|.|:  :|.:...||:|:|:|:||||.:.|:
  Fly    28 GRSFDAESHPIKYAEEQQTQYW--VDKAQAKLLSKLAE--QESATTNKAKNVILFLGDGMSVHTV 88

  Fly   101 SAGRIYKGQYLKHGYGEEETLVFDDFPNTGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMD 165
            :|.|...|.       ..|.:.|:.||.||::|||.|::||.|||.||||...|.|.:||.||::
  Fly    89 TATRNLLGD-------SAEQVYFEGFPYTGLSKTYCVNRQVADSACTATAYLGGVKANYGTIGVN 146

  Fly   166 ATRSKKN-----GQQGRVQSVMEWAQKEGKRTGVVTTTRITHATPAATYAHIYDRDWECDTEV-- 223
            |..|:.:     .::.||.|:..|||..||..|:|||.|:|||:||..||||.||:||.|.||  
  Fly   147 ANVSRYSCDGAANEEDRVLSIAHWAQAAGKDAGLVTTARVTHASPAGVYAHIADRNWENDWEVAN 211

  Fly   224 ----PAESVGFHVDIARQLVENAPGNRFNVILGGGMSPMGILNASEVKTTIFEG-PTETICTRGD 283
                |.::    :||||||||...|.:..||||||..     |..:......|| |.:    |.|
  Fly   212 RECDPEQT----IDIARQLVEQPVGQQLKVILGGGRK-----NFIDATVNDEEGYPGK----RTD 263

  Fly   284 NRNLPAEWLAHHANDTVPPALVHNRKDLLNVNVKKVDHLMGLFRNNHITYSIAR-----EAGEPS 343
            .|:|...||.......|....|.:||.|..|:::..|:|:|||.|:|:.|:..|     :..:||
  Fly   264 GRHLIRSWLDQKKEANVSAKYVWSRKGLSLVDLENTDYLLGLFANDHLPYNGDRDRKRSQLADPS 328

  Fly   344 LQEMTETALGILERGDESNGFVLLVEGGRIDQGHHMNYARAALHELYEFDLAIQAAVNNTDPDET 408
            |.|:||.|:.:|.|.|:  ||.|.|||.|||..||..:|:.:|.:..||..|:|.|...|..|:|
  Fly   329 LSELTEAAITVLSRNDK--GFFLFVEGARIDMAHHDTFAKRSLEDTAEFARAVQKARELTSEDDT 391

  Fly   409 LILVTADHSHAVTFNGYALRGADILGTANSHEKNDPMFYETISYANGPGYWDHLANDSRPQNSSN 473
            ||:|||||:|.::.|||..|..:|.|.|...:.|.|  |..:||||||||:.             
  Fly   392 LIVVTADHAHVMSINGYPYRDQEITGLAQLADDNLP--YTILSYANGPGYYS------------- 441

  Fly   474 MWMPLKHFTAEERAA--------PTYRHLATVPRKDETHGGEDVAVFAYGPGSSLIRGVFEQNYL 530
                 .:..||.||.        ..|::....|...|||||:||||:|.||.:....|.:||:.:
  Fly   442 -----GYNRAEGRALLKEKLVADSDYQYPTLAPLDAETHGGDDVAVYASGPYAQYFSGNYEQSNI 501

  Fly   531 AYVMSYAGCLGP 542
            ..:|:.|..:||
  Fly   502 PALMARAAGIGP 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 193/499 (39%)
alkPPc 85..541 CDD:214515 188/481 (39%)
Alp6NP_610496.1 ALP_like 72..511 CDD:304875 189/481 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455949
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.