DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp4 and SPBC14F5.13c

Sequence 1:NP_524601.2 Gene:Alp4 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_596739.1 Gene:SPBC14F5.13c PomBaseID:SPBC14F5.13c Length:532 Species:Schizosaccharomyces pombe

Alignment Length:547 Identity:141/548 (26%)
Similarity:217/548 (40%) Gaps:145/548 (26%)


  Fly    76 KEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQYL--KHGY--GEEETLVFDDFPNTGMAKTYN 136
            |.....:|.:.:|:.:.||||..::|..|.:. :.|  |.||  ..:|.|:       |.::|.:
pombe    51 KSKGTNEKPKFVIMMVSDGMGPGSLSMTRSFV-ETLNDKEGYRLPLDEHLI-------GSSRTRS 107

  Fly   137 VDKQVPDSAGTATAIFSGSKTHYGAIGMDATRSKKNGQQGRVQSVMEWAQKEGKRTGVVTTTRIT 201
            ....:.|||..|||....:||:.||:|: ....|..|      :::|.|::.|..||:|.|:|:|
pombe   108 SSSLITDSAAGATAFSCANKTYNGAVGV-LDNEKPCG------TILEAAKEAGYLTGIVVTSRVT 165

  Fly   202 HATPAATYAHIYDRDWECDTEVPAESVGFHVD-IARQLVENAP-GNRFNVILGGGMSPMGILNAS 264
            .||||:..||..:|              |..| ||...|...| |...:::.|||:         
pombe   166 DATPASFSAHAANR--------------FMQDLIAEYQVGMGPLGRSVDLLFGGGL--------- 207

  Fly   265 EVKTTIFEGPTETICTRGDNRNLPAEWLAHHANDTVPPALVHNRKD---LLNVNVKKVDHLMGLF 326
               .:.....|...| |.||.:     |..:|.......::.||.|   |.|..:.    |:|||
pombe   208 ---CSFLPKSTYRSC-RSDNLD-----LLKYARKKEGFQILLNRTDFDELSNAQLP----LLGLF 259

  Fly   327 RNNHITYSIAREAG-EPSLQEMTETALGIL---ERGDESNGFVLLVEGGRIDQGHHMNYARAALH 387
            .:.|::|.|..:.. :|.|.||.||||.:|   ...|.|.||.||:||.|||...|.|...|.::
pombe   260 SDYHLSYDIDYQPEVQPKLSEMVETALDVLLNATNEDTSKGFFLLIEGSRIDMASHNNDPIAHVY 324

  Fly   388 ELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNG------------------YALRGADILG 434
            |:.|::.|.:.|....:.:...::.|:||.......|                  .||...:.|.
pombe   325 EVMEYNRAFEIASAFVEKNGGSLISTSDHETGGLTVGRQVSKKYPEYLWKPQVLSLALHSIEYLA 389

  Fly   435 TA-NSHEKND--PMFYETISYANGPGYWDHLANDSRPQNSSNMWMPLKHFTAEERAAPTYRH--- 493
            :| .:|.:|.  |...:.:..|.|       ..|..|:...::::.              ||   
pombe   390 SAIVNHNQNTLLPYIEQFVLPAIG-------IPDPNPKQIHDIYVA--------------RHNIF 433

  Fly   494 -----LATVPRKD-----ETHGGEDVAVFAYGPG----------SSLIRGVFEQNYLAYVMSYAG 538
                 |:.:...:     .|||...|.|..||.|          .::..|.|.:.||...:|   
pombe   434 NLINVLSDIVSVEAQIGWTTHGHTAVDVNVYGVGEVTEHLRGNMENIEIGQFMEIYLNVSLS--- 495

  Fly   539 CLGPAKDFDDSCEDHKD----GQKDRP 561
                     |..|..||    |..|||
pombe   496 ---------DVTEKLKDAPIHGAPDRP 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 132/515 (26%)
alkPPc 85..541 CDD:214515 131/513 (26%)
SPBC14F5.13cNP_596739.1 PhoA 3..495 CDD:224699 132/516 (26%)
ALP_like 60..487 CDD:304875 128/499 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1439
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T631406
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.