DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp4 and ALPP

DIOPT Version :8

Sequence 1:NP_524601.2 Gene:Alp4 / 43671 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001623.3 Gene:ALPP / 250 HGNCID:439 Length:535 Species:Homo sapiens

Alignment Length:599 Identity:243/600 (41%)
Similarity:317/600 (53%) Gaps:84/600 (14%)


  Fly     3 CLVILGFLLGSLVAFSWAGVTTQPPPLIRTLSAGGDIGPQFDVGKTKEPEDAEFWHNVGLRQLEK 67
            |:::|..|||                |...||.|  |.|       .|.|:.:||:    |:..:
Human     5 CMLLLLLLLG----------------LRLQLSLG--IIP-------VEEENPDFWN----REAAE 40

  Fly    68 TIKQAQRVKEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQYLKHGYGEEETLVFDDFPNTGMA 132
            .:..|::::  ..|..|:|:|||:|||||:||::|.||.||| .|...|.|..|..|.||...::
Human    41 ALGAAKKLQ--PAQTAAKNLIIFLGDGMGVSTVTAARILKGQ-KKDKLGPEIPLAMDRFPYVALS 102

  Fly   133 KTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDATR--SKKNGQQG-RVQSVMEWAQKEGKRTGV 194
            |||||||.||||..||||...|.|.::..||:.|..  ::.|..:| .|.|||..|:|.||..||
Human   103 KTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGV 167

  Fly   195 VTTTRITHATPAATYAHIYDRDWECDTEVPAES--VGFHVDIARQLVENAPGNRFNVILGGG--- 254
            |||||:.||:||.||||..:|:|..|.:|||.:  .|.. |||.||:.|..   .:||||||   
Human   168 VTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQ-DIATQLISNMD---IDVILGGGRKY 228

  Fly   255 MSPMGILNASEVKTTIFEGPTETICTRGDNRNLPAEWLAHHANDTVPPALVHNRKDLLNVNV-KK 318
            |..||..: .|......:|.     ||.|.:||..||||....    ...|.||.:|:..:: ..
Human   229 MFRMGTPD-PEYPDDYSQGG-----TRLDGKNLVQEWLAKRQG----ARYVWNRTELMQASLDPS 283

  Fly   319 VDHLMGLFRNNHITYSIAREAG-EPSLQEMTETALGILERGDESNGFVLLVEGGRIDQGHHMNYA 382
            |.||||||....:.|.|.|::. :|||.||||.||.:|.|  ...||.|.|||||||.|||.:.|
Human   284 VTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSR--NPRGFFLFVEGGRIDHGHHESRA 346

  Fly   383 RAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGYALRGADILGTANSHEKNDPMFY 447
            ..||.|...||.||:.|...|..::||.||||||||..:|.||.|||:.|.|.|.. :..|...|
Human   347 YRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPG-KARDRKAY 410

  Fly   448 ETISYANGPGYWDHLANDSRPQNSSNMWMPLKHFTAEERAAPTYRHLATVPRKDETHGGEDVAVF 512
            ..:.|.|||||  .|.:.:||.           .|..|..:|.||..:.||..:|||.|||||||
Human   411 TVLLYGNGPGY--VLKDGARPD-----------VTESESGSPEYRQQSAVPLDEETHAGEDVAVF 462

  Fly   513 AYGPGSSLIRGVFEQNYLAYVMSYAGCLGPAKDFDDSCEDHKDGQKDRPLDKPNPKRNGATVVGA 577
            |.||.:.|:.||.||.::|:||::|.||.|....|.:          .|....:....|.:||.|
Human   463 ARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLA----------PPAGTTDAAHPGRSVVPA 517

  Fly   578 SLIPILTAATAAIL 591
             |:|:| |.|..:|
Human   518 -LLPLL-AGTLLLL 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 211/484 (44%)
alkPPc 85..541 CDD:214515 211/466 (45%)
ALPPNP_001623.3 PRK10518 28..478 CDD:236706 212/487 (44%)
Alk_phosphatase 55..490 CDD:278666 211/466 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21907865
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H122414
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.