DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp4 and ALPL

DIOPT Version :8

Sequence 1:NP_524601.2 Gene:Alp4 / 43671 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_000469.3 Gene:ALPL / 249 HGNCID:438 Length:524 Species:Homo sapiens

Alignment Length:503 Identity:210/504 (42%)
Similarity:290/504 (58%) Gaps:42/504 (8%)


  Fly    49 KEPEDAEFWHNVGLRQLEKTIKQAQRVKEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQYLKH 113
            ::.:|.::|.:    |.::|:|.|..:::.: ...|:|:|:|:|||||:||::|.||.||| |.|
Human    21 EKEKDPKYWRD----QAQETLKYALELQKLN-TNVAKNVIMFLGDGMGVSTVTAARILKGQ-LHH 79

  Fly   114 GYGEEETLVFDDFPNTGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDAT--RSKKNGQQG 176
            ..|||..|..|.||...::||||.:.|||||||||||...|.|.:.|.:|:.|.  ||:.|..||
Human    80 NPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQG 144

  Fly   177 -RVQSVMEWAQKEGKRTGVVTTTRITHATPAATYAHIYDRDWECDTEVPAESVGFHV-DIARQLV 239
             .|.|::.||:..||..|:|||||:.||||:|.|||..||||..|.|:|.|::.... |||.||:
Human   145 NEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLM 209

  Fly   240 ENAPGNRFNVILGGGMSPMGILNASEVKTTIFEGPTETICTRGDNRNLPAEWLA-----HHANDT 299
            .|.  ...:||:|||...|...|.::|:   :|...:...||.|..:|...|.:     .|::  
Human   210 HNI--RDIDVIMGGGRKYMYPKNKTDVE---YESDEKARGTRLDGLDLVDTWKSFKPRYKHSH-- 267

  Fly   300 VPPALVHNRKDLLNVNVKKVDHLMGLFRNNHITYSIAR-EAGEPSLQEMTETALGILERGDESNG 363
                .:.||.:||.::...||:|:|||....:.|.:.| ...:|||.||...|:.||.:..:  |
Human   268 ----FIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPK--G 326

  Fly   364 FVLLVEGGRIDQGHHMNYARAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGYALR 428
            |.|||||||||.|||...|:.||||..|.|.||..|.:.|..::||.:|||||||..||.||..|
Human   327 FFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPR 391

  Fly   429 GADILGTANSHEKNDPMFYETISYANGPGYWDHLANDSRPQNSSNMWMPLKHFTAEERAAPTYRH 493
            |..|.|.|......|...:..|.|.|||||  .:....| :|.|.:          :.|...|:.
Human   392 GNSIFGLAPMLSDTDKKPFTAILYGNGPGY--KVVGGER-ENVSMV----------DYAHNNYQA 443

  Fly   494 LATVPRKDETHGGEDVAVFAYGPGSSLIRGVFEQNYLAYVMSYAGCLG 541
            .:.||.:.|||||||||||:.||.:.|:.||.||||:.:||:||.|:|
Human   444 QSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIG 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 203/484 (42%)
alkPPc 85..541 CDD:214515 202/466 (43%)
ALPLNP_000469.3 Alk_phosphatase 51..490 CDD:333956 203/466 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21906324
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.