DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp4 and ALPI

Sequence 1:NP_524601.2 Gene:Alp4 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001622.2 Gene:ALPI HGNCID:437 Length:528 Species:Homo sapiens

Alignment Length:557 Identity:238/558 (43%)
Similarity:308/558 (55%) Gaps:73/558 (13%)


  Fly    50 EPEDAEFWHNVGLRQLEKTIKQAQRVKEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQYLKHG 114
            |.|:..||:    ||..:.:..|::::  ..||.|:|:|:|:|||:|:.|::|.||.|||  |:|
Human    24 EEENPAFWN----RQAAEALDAAKKLQ--PIQKVAKNLILFLGDGLGVPTVTATRILKGQ--KNG 80

  Fly   115 -YGEEETLVFDDFPNTGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDATR--SKKNGQQG 176
             .|.|..|..|.||...::||||||:||||||.||||...|.|.::..||:.|..  ::.|..:|
Human    81 KLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRG 145

  Fly   177 -RVQSVMEWAQKEGKRTGVVTTTRITHATPAATYAHIYDRDWECDTEVPAES--VGFHVDIARQL 238
             .|.|||..|::.||..|||||||:.||:||.||||..:|:|..|.::||.:  .|.. |||.||
Human   146 NEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQ-DIATQL 209

  Fly   239 VENAPGNRFNVILGGG---MSPMGILNASEVKTTIFEGPTETICT--RGDNRNLPAEWLAHHAND 298
            :.|..   .:||||||   |.|||        |...|.|.:....  |.|.:||..||||.|.. 
Human   210 ISNMD---IDVILGGGRKYMFPMG--------TPDPEYPADASQNGIRLDGKNLVQEWLAKHQG- 262

  Fly   299 TVPPALVHNRKDLLNVNV-KKVDHLMGLFRNNHITYSIAREAG-EPSLQEMTETALGILERGDES 361
               ...|.||.:|:..:: :.|.||||||......|.|.|:.. :|||.||||.||.:|.|  ..
Human   263 ---AWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSR--NP 322

  Fly   362 NGFVLLVEGGRIDQGHHMNYARAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGYA 426
            .||.|.|||||||.|||...|..||.|...||.||:.|...|..::||.||||||||..:|.||.
Human   323 RGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYT 387

  Fly   427 LRGADILGTANSHEKNDPMFYETISYANGPGYWDHLANDS-RPQ-NSSNMWMPLKHFTAEERAAP 489
            |||:.|.|.|.| :..|...|.:|.|.|||||   :.|.. ||. |.|            |..:|
Human   388 LRGSSIFGLAPS-KAQDSKAYTSILYGNGPGY---VFNSGVRPDVNES------------ESGSP 436

  Fly   490 TYRHLATVPRKDETHGGEDVAVFAYGPGSSLIRGVFEQNYLAYVMSYAGCLGPAKDFDDSCEDHK 554
            .|:..|.||...||||||||||||.||.:.|:.||.||:::|:||::|.||.|.    .:|:   
Human   437 DYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPY----TACD--- 494

  Fly   555 DGQKDRPLDKPNPKRNGATVVGASLIPILTAATAAIL 591
                   |..|....:.|..|.||| |:| |.|..:|
Human   495 -------LAPPACTTDAAHPVAASL-PLL-AGTLLLL 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 216/489 (44%)
alkPPc 85..541 CDD:214515 214/471 (45%)
ALPINP_001622.2 Alk_phosphatase 52..487 CDD:306706 214/471 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21922323
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.