DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp4 and alpi.2

DIOPT Version :8

Sequence 1:NP_524601.2 Gene:Alp4 / 43671 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001116946.1 Gene:alpi.2 / 100144722 XenbaseID:XB-GENE-854953 Length:532 Species:Xenopus tropicalis

Alignment Length:563 Identity:212/564 (38%)
Similarity:290/564 (51%) Gaps:83/564 (15%)


  Fly    45 VGKTKEPEDAEFWHNVGLRQLEKTIKQAQRVKEDSYQKKARNIIIFIGDGMGISTISAGRIYKGQ 109
            |...:..::.:||::    |.::|:|.|..:...::  :|:|:|:|:|||||::||:|.|||:||
 Frog    33 VSSLEAEKNPKFWND----QAKETLKNALNLNPITH--RAKNLIMFLGDGMGVTTIAAARIYQGQ 91

  Fly   110 YLKHGYGEEETLVFDDFPNTGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDA-------T 167
             ::...|||..:..:.||...::|.||||.||||||||.||...|.|.:.|.:|:.|       .
 Frog    92 -VEGQPGEENIMAMEKFPYVALSKVYNVDAQVPDSAGTGTAYLCGVKANSGTLGVSAAAIYGNCV 155

  Fly   168 RSKKNGQQGRVQSVMEWAQKEGKRTGVVTTTRITHATPAATYAHIYDRDWECDTEVPAESVGFHV 232
            .||.|    .|.|::..|:..||..|:|||||:.||:|.|.|||...|:|..|.|:.:..:....
 Frog   156 SSKGN----EVTSILHRAKLAGKSVGIVTTTRVQHASPGAAYAHSASRNWYSDNEMTSAMINNGC 216

  Fly   233 -DIARQLVENAPGNRFNVILGGG---MSPMGILNASEVKTTIFEGPTETICTRGDNRNLPAEWLA 293
             |||.|||.|..   .:||||||   |.|.|..:..      :.|.:.....|.|..||...||:
 Frog   217 KDIAYQLVHNTD---IDVILGGGRAYMYPAGTPDPE------YPGSSADRGLRRDGLNLTDIWLS 272

  Fly   294 HHANDTVPPALVHNRKDLLNVNVKKVDHLMGLFRNNHITYSIAREAG-EPSLQEMTETALGILER 357
            ...|    ...|.|::....|||...|:|||||....:.|.:.|.|. :|||.||||.|:.||.:
 Frog   273 KRQN----ARYVWNKEQFNAVNVDTTDYLMGLFEPKDMKYELNRNASLDPSLAEMTEKAIRILSK 333

  Fly   358 GDESNGFVLLVEGGRIDQGHHMNYARAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTF 422
            ..:  ||.|.|||||||.|||...|:.:|.|..|||.|:......|..:|||.:|||||||..||
 Frog   334 NPK--GFFLFVEGGRIDHGHHDGNAKQSLTEALEFDKAVLRGGQLTQENETLTVVTADHSHVFTF 396

  Fly   423 NGYALRGADILGTANSHEKNDPMFYETISYANGPGYWDHLANDSRPQNSSNMWMPL-----KHFT 482
            .||..||..|.|.|.| ..:|...|.::.|.|||||                  ||     .:.|
 Frog   397 GGYTDRGNSIFGLAPS-LASDRKPYTSLLYGNGPGY------------------PLPDAIRANIT 442

  Fly   483 AEERAAPTYRHLATVPRKDETHGGEDVAVFAYGPGSSLIRGVFEQNYLAYVMSYAGCLGPAKDFD 547
            .....:.:|...|.||...|||||||||:.|.||.:.|..|..||:|:|:||:||.||.|..:  
 Frog   443 GVNTGSNSYLQQAAVPVVSETHGGEDVAIMAKGPQAHLFHGFHEQSYIAHVMAYAACLEPYTE-- 505

  Fly   548 DSCEDHKDGQKDRPLDKPNPKRNGATVVGASLIPILTAATAAI 590
              |..                 ||.::..|:::|:|||....|
 Frog   506 --CPP-----------------NGGSIYTATILPLLTACLVCI 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp4NP_524601.2 PhoA 60..534 CDD:224699 194/491 (40%)
alkPPc 85..541 CDD:214515 194/473 (41%)
alpi.2NP_001116946.1 Alk_phosphatase 66..500 CDD:278666 194/473 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.