DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CanA1 and CanA-14F

Sequence 1:NP_001247378.2 Gene:CanA1 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001245717.1 Gene:CanA-14F FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster

Alignment Length:574 Identity:394/575 (69%)
Similarity:469/575 (82%) Gaps:31/575 (5%)


  Fly     2 SATSTRSSVTRKSSLSKSSSSDKSAKSSSNSSKSPTAASGNKQKMQYTKTRERMVDDVPLPPTHK 66
            :||:..::.:.....:.|:.:.:..:..:.:|..|::.:    |.....|:||::|.|..||:.|
  Fly    41 AATTGTAAGSGSGGAAGSAGTQQQGQGGTGTSSGPSSPT----KRSTISTKERVIDSVAFPPSRK 101

  Fly    67 LTMSEVYDDPKTGKPNFDALRQHFLLEGRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDI 131
            ||.::|: |.:||||..|.|:|||:|||||||:.|||||.|||.|||.||.|||:|||:||||||
  Fly   102 LTCADVF-DARTGKPQHDVLKQHFILEGRIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDI 165

  Fly   132 HGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHL 196
            ||||:||:||||:||.||||:|||||||||||||||||||||||||||||.||.|||||||||||
  Fly   166 HGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHL 230

  Fly   197 TEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREP 261
            ||||||||||.|||||.:|||||:||||||||||:||||||:||||||||..|:||:.|:||:||
  Fly   231 TEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEP 295

  Fly   262 PAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDA 326
            ||:|||||||||||||||||||.::|::||||||||||:||:|||:|||.||||||:||||||||
  Fly   296 PAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDA 360

  Fly   327 GYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT 391
            |||||||:|.|||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   361 GYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT 425

  Fly   392 WSLPFVGEKVTEMLVNILNICSDDELVAGPDDELEEELRKKIVLVPANASNNNNNNNTPSKPASM 456
            ||||||||||||||||:|||||||||:.   :|.||.|           |::.            
  Fly   426 WSLPFVGEKVTEMLVNVLNICSDDELMT---EESEEPL-----------SDDE------------ 464

  Fly   457 SALRKEIIRNKIRAIGKMSRVFSILREESESVLQLKGLTPTGALPVGALSGGRDSLKEALQGLTA 521
            :|||||:|||||||||||:||||:|||||||||||||||||||||:||||||:.|||.|:||.:.
  Fly   465 AALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNAMQGFSP 529

  Fly   522 SSHIHSFAEAKGLDAVNERMPPRRPLLMSASSSSITTVTRSSSSSSNNNNNNSN 575
            :..|.|||||||||||||||||||....|.:.....:::.::::::|.|.|:.|
  Fly   530 NHKITSFAEAKGLDAVNERMPPRRDATPSPAEEGQKSLSAAAAAAANANANSIN 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 258/304 (85%)
PP2Ac 98..369 CDD:197547 230/271 (85%)
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 258/304 (85%)
PP2Ac 132..403 CDD:197547 230/271 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292780993
eggNOG 1 0.900 E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 789 1.000 Inparanoid score I257
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D194337at33208
OrthoFinder 1 1.000 FOG0000536
orthoMCL 1 0.900 OOG5_127131
Panther 1 1.100 P PTHR45673
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.