DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CanA1 and YNL217W

Sequence 1:NP_001247378.2 Gene:CanA1 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_014182.1 Gene:YNL217W SGDID:S000005161 Length:326 Species:Saccharomyces cerevisiae

Alignment Length:287 Identity:60/288 (21%)
Similarity:104/288 (36%) Gaps:75/288 (26%)


  Fly   112 LREEKNMIDVEAPITVCGDIHGQFFDLVKLFE--VGGPPATTRYLFLGDYVDRGYFSIECVLYLW 174
            |::.:::.|:.......||:||.:.:.::|.:  :||.......:.|||::.:|..|.:.|.|: 
Yeast    50 LKKIEHVTDLNKEYVFVGDVHGNYDEFIELIDDKIGGLGENITMILLGDFIHKGPDSDKVVSYI- 113

  Fly   175 SLKITYPTTLSLLRGNHECRHLTEY-----------------FTFKQEC------IIKYSES--- 213
               :.:...:..:.||||...:..|                 .||..|.      |.|.|.:   
Yeast   114 ---LNHKDQVKCVLGNHEILVMMAYLNPDFSKWVRRPKLMTPLTFSTETNFIPQDISKISNAHGR 175

  Fly   214 ------------IYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIF----------TLDDIKTL- 255
                        :.:.|..|.: |.| .:........|.|:.|..|          :|.::|.: 
Yeast   176 LARELGFSKLSQLAEHCSMAIE-LDL-DITGDILFGAHAGMVPGDFMKPNQIPGVSSLSNMKYVD 238

  Fly   256 -------NRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSY----SACCEFL 309
                   :|.:|...| .....||....:.|.|.|.  |:.|::..|.:.....    :||.   
Yeast   239 KKNWSKTSREKENKNY-VRWYTLWDKYGDHFSNAKV--FYGHDASMGLNLRRQTKGLDTACI--- 297

  Fly   310 QKNNLLSIVRAHEAQDAGYRMYRKNQV 336
             ||||||.::.......|...|...||
Yeast   298 -KNNLLSSMKVKYDIKKGQYDYELIQV 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 60/288 (21%)
PP2Ac 98..369 CDD:197547 60/288 (21%)
YNL217WNP_014182.1 MPP_PPP_family 64..307 CDD:277316 54/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.