DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CanA1 and ppp5c

Sequence 1:NP_001247378.2 Gene:CanA1 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001007891.1 Gene:ppp5c XenbaseID:XB-GENE-982044 Length:493 Species:Xenopus tropicalis

Alignment Length:393 Identity:123/394 (31%)
Similarity:196/394 (50%) Gaps:30/394 (8%)


  Fly     1 MSATSTRSSVTRKSSLSKSSSSDKSAKSSSNSSKSPTAASGNKQKMQYTKTRERMVDDVPLPPTH 65
            |:....::::....::.|....||.|:...............::.:...:....:||.:.:   .
 Frog   101 MALGKLKAALKDYETVVKVRPHDKDAQMKFQECSKLVRQKAFERAIACEQHNRSVVDSLDI---E 162

  Fly    66 KLTMSEVYDDP--KTGKPNFD---ALRQHFLLEGRIEEAVALRIITEGAALLREEKNMIDV---- 121
            .:|:.:.|..|  |.|....|   .|.|.:..:.::......:::.:...:|.:..:::::    
 Frog   163 GMTIEDEYTGPQLKDGNVTIDFMLELMQFYKDQKKLHRKCVYQMLVQVKDILSKLPSLVEISLEK 227

  Fly   122 EAPITVCGDIHGQFFDLVKLFEVGGPPATTR-YLFLGDYVDRGYFSIECVLYLWSLKITYPTTLS 185
            ...:|||||.||||:||:.:|.:.|.|:... |:|.||:||||.||:|.::.|:..|:.||....
 Frog   228 SQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAQFH 292

  Fly   186 LLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGL-SPEIFTL 249
            |||||||...:.:.:.|:.|...|||..::....|.|..||||..:||:.|.:|||| |.:..||
 Frog   293 LLRGNHETDTMNQMYGFEGEVKAKYSAQMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTL 357

  Fly   250 DDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNL 314
            |.|:::.|.|:||..|||||||||||....|..        :|.||.|..|.......||::|.|
 Frog   358 DQIRSIERNRQPPDSGPMCDLLWSDPQPQDGRS--------SSKRGVSCQFGPDVTRRFLEENGL 414

  Fly   315 LSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM--NIRQFNCS 377
            ..|:|:||.:..||      :|:.....:|:||||||.|...||.|.:....:.:  ...||...
 Frog   415 DYIIRSHEVKPEGY------EVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGSDLKPKFHQFEAV 473

  Fly   378 PHP 380
            |||
 Frog   474 PHP 476

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 111/312 (36%)
PP2Ac 98..369 CDD:197547 103/277 (37%)
ppp5cNP_001007891.1 PLN03088 22..>232 CDD:330826 16/134 (12%)
TPR repeat 22..50 CDD:276809
TPR repeat 55..85 CDD:276809
TPR repeat 90..118 CDD:276809 1/17 (6%)
MPP_PP5_C 170..485 CDD:277362 115/322 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.