| Sequence 1: | NP_001247378.2 | Gene: | CanA1 / 43670 | FlyBaseID: | FBgn0010015 | Length: | 622 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001021823.2 | Gene: | Y71G12B.30 / 3565302 | WormBaseID: | WBGene00044347 | Length: | 333 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 323 | Identity: | 107/323 - (33%) | 
|---|---|---|---|
| Similarity: | 168/323 - (52%) | Gaps: | 31/323 - (9%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    55 MVDDVPLP--PTHKLTMSEVYDDPKTGKP-NFDALRQHFLLEGRIEEAVALRIITEGAALLREEK 116 
  Fly   117 NMIDVEAPITVCGDIHGQFFDLVKLFEVGGPP------ATTRYLFLGDYVDRGYFSIECVLYLWS 175 
  Fly   176 LKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHG 240 
  Fly   241 GLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSAC 305 
  Fly   306 CEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNV 368  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CanA1 | NP_001247378.2 | MPP_PP2B | 81..385 | CDD:277361 | 101/295 (34%) | 
| PP2Ac | 98..369 | CDD:197547 | 98/277 (35%) | ||
| Y71G12B.30 | NP_001021823.2 | PP2Ac | 36..308 | CDD:197547 | 98/279 (35%) | 
| MPP_superfamily | 36..304 | CDD:301300 | 98/279 (35%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0639 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53795 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.820 | |||||