DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CanA1 and Y71G12B.30

Sequence 1:NP_001247378.2 Gene:CanA1 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans

Alignment Length:323 Identity:107/324 (33%)
Similarity:168/324 (52%) Gaps:31/324 (10%)


  Fly    55 MVDDVPLP--PTHKLTMSEVYDDPKTGKP-NFDALRQHFLLEGRIEEAVALRIITEGAALLREEK 116
            |.|:.|.|  |.|:...:.::...::..| |...|         .:|...:.|.........:|.
 Worm     1 MSDEGPPPGSPLHRKLTNVIFRLTQSWSPGNCQTL---------FQEKEIIEICYRAREAFWKEP 56

  Fly   117 NMIDVEAPITVCGDIHGQFFDLVKLFEVGGPP------ATTRYLFLGDYVDRGYFSIECVLYLWS 175
            ..:::|||:|:||||||||.||:.:|::.|.|      .::||||||||:|||.||||.:..|::
 Worm    57 MKLEIEAPVTICGDIHGQFEDLLSMFDIYGFPHVSQKDKSSRYLFLGDYIDRGPFSIEVITLLFA 121

  Fly   176 LKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHG 240
            .::.:|..:.|||||||.|.:...:.|..||..:||.::|:....||.|:||.|::..:.:|:||
 Worm   122 YRLLHPQKMFLLRGNHESRPVNMQYGFYNECKRRYSVTLYETFQWAFYCMPLCAIVGGRIMCMHG 186

  Fly   241 GLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSAC 305
            |:...:.:|:.|....|..:....|...||.|:||:       :......:|.||..:.|..:..
 Worm   187 GIPFGLLSLEQIDEFQRPTDIADVGIPSDLCWADPV-------SGVVGFQDSPRGAGHVFGEATV 244

  Fly   306 CEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNV 368
            .||.:|..|..|||||:....||..:...:      |:||||||.|...::|..|||:...|:
 Worm   245 KEFNEKFKLDLIVRAHQVVMDGYEFFADKK------LVTIFSAPCYCGHFDNLGAVLQVATNM 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 101/296 (34%)
PP2Ac 98..369 CDD:197547 98/278 (35%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 98/280 (35%)
MPP_superfamily 36..304 CDD:301300 98/280 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.