DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA1 and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_037197.1 Gene:Ppp1cb / 25594 RGDID:3376 Length:327 Species:Rattus norvegicus


Alignment Length:308 Identity:111/308 - (36%)
Similarity:172/308 - (55%) Gaps:29/308 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GKPNFDALRQHFLLEGR---------IEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQ 134
            |:.|.|:|... |||.|         :.||....:..:...:...:..::::|||:.:|||||||
  Rat     4 GELNVDSLITR-LLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQ 67

  Fly   135 FFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEY 199
            :.||::|||.||.|....|||||||||||..|:|.:..|.:.||.||....||||||||..:...
  Rat    68 YTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRI 132

  Fly   200 FTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAY 264
            :.|..||..:::..::....:.|:|||:||:::::..|.||||||::.:::.|:.:.|..:.|..
  Rat   133 YGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDT 197

  Fly   265 GPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYR 329
            |.:||||||||.:|......|:       ||.|:.|......:||.:::|..|.|||:..:.||.
  Rat   198 GLLCDLLWSDPDKDVQGWGEND-------RGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYE 255

  Fly   330 MYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 377
            .:.|.|      |:|:||||||...::|...::..:..:|      ||
  Rat   256 FFAKRQ------LVTLFSAPNYCGEFDNAGGMMSVDETLM------CS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 110/306 (36%)
PP2Ac 98..369 CDD:197547 100/270 (37%)
Ppp1cbNP_037197.1 MPP_PP1_PPKL 7..297 CDD:277359 110/305 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.