DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CanA1 and C27B7.6

Sequence 1:NP_001247378.2 Gene:CanA1 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_501547.3 Gene:C27B7.6 WormBaseID:WBGene00007763 Length:454 Species:Caenorhabditis elegans

Alignment Length:532 Identity:143/533 (27%)
Similarity:215/533 (40%) Gaps:148/533 (28%)


  Fly    86 LRQHFLLEGRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLF-EVGGPPA 149
            :.::..||| ..::..|.::.....:|.....:|::.||:.|.||||||..||::.. |||.|| 
 Worm    22 IEKYGTLEG-FSDSDILEVLKTIKEILEPLPCLIEIIAPVVVFGDIHGQLGDLLQFTNEVGRPP- 84

  Fly   150 TTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESI 214
            ..:|||||||||||..|:|..::|:.:||.:...:.|||||||.|.:...:.||:|.:.|.:..:
 Worm    85 DFQYLFLGDYVDRGPNSLEVTVWLFCMKILFSKKVHLLRGNHEVRRVNTMYGFKEEMMRKRNSHL 149

  Fly   215 YDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDI--KTLNRFREPPAYGPMCDLLWSDPLE 277
            :....:.|..|.:.|.:|::.||:|||:||:|.:.|.:  .|..|......:|.:.||:||||  
 Worm   150 WKVFNDVFAELSICASINRKILCMHGGISPKIESWDSLTGMTKPRVHGDCEHGLIVDLIWSDP-- 212

  Fly   278 DFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLS------IVRAHEAQDAGYRMYRKNQV 336
               |.| ::....|.:||.|..|..|..      :||.:      |:||||.::.|:.....|: 
 Worm   213 ---NRK-DDTIQFNKMRGISTLFGKSVV------DNLCTTLAIDLIIRAHEMKEKGHTFEFDNR- 266

  Fly   337 TGFPSLITIFSAPNYLDVYNNKAAV------LKY------------------------------- 364
                 |:|:||||.|....:|..:|      ||.                               
 Worm   267 -----LLTVFSAPYYSGHNSNLGSVATISKSLKLRIVTLKPNKGYDRSKLDKRTLHDFEKNFQPL 326

  Fly   365 -ENNVMNIR-QFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELVAGPDDELEE 427
             ||...||. |||..|:...:.          ||:||  ..|..:....|..|            
 Worm   327 DENPRKNISCQFNVPPNGQKMS----------PFLGE--YSMFAHETQFCKKD------------ 367

  Fly   428 ELRKKIVLVPANASNNNNNNNTPSKPASMSALRKEIIRNKIRAIGKMSRVFSILREESESVLQLK 492
                               |.||.|                       :.:|..::|..|||.:.
 Worm   368 -------------------NETPVK-----------------------KPYSSNQDEDHSVLDMI 390

  Fly   493 GLTPTGALPVGALSGGRDSLKEALQGLTASSHIHSFAEAKGLDAVNERMPPRRPLLMSASSSSIT 557
            ..|..|       .|...|||:.:..|      .|..:..|:.......|||.| ...|..:...
 Worm   391 RKTQKG-------YGVEVSLKDKVMSL------ESIRKKLGMTTSTTPPPPRTP-SPDAPLAQSP 441

  Fly   558 TVTRSSSSSSNN 569
            .:.||..||:.|
 Worm   442 PIPRSPPSSTEN 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 108/347 (31%)
PP2Ac 98..369 CDD:197547 99/318 (31%)
C27B7.6NP_501547.3 PP2Ac 31..304 CDD:197547 97/292 (33%)
MPP_PPP_family 61..289 CDD:277316 90/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.