DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CanA1 and Ppp3cc

Sequence 1:NP_001247378.2 Gene:CanA1 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_008769035.1 Gene:Ppp3cc RGDID:621616 Length:515 Species:Rattus norvegicus

Alignment Length:516 Identity:358/517 (69%)
Similarity:420/517 (81%) Gaps:38/517 (7%)


  Fly    40 SGNKQKMQYTKTRERMVDDVPLPPTHKLTMSEVYDDPKTGKPNFDALRQHFLLEGRIEEAVALRI 104
            ||.:.:.   .|.||::..||.|||.:||:.||:::   |||..|.|:.|.:.|||:||.|||:|
  Rat     2 SGRRPQF---STTERVIKAVPFPPTRRLTLKEVFEN---GKPKMDVLKNHLVKEGRVEEDVALKI 60

  Fly   105 ITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIEC 169
            |.:|||:|::||.|::||||||||||:|||||||:|||||||.|:.|||||||||||||||||||
  Rat    61 INDGAAILKQEKTMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIEC 125

  Fly   170 VLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQ 234
            |||||||||.:|.||.|||||||||||||||||||||.|||||.:|:|||..|||||||||||||
  Rat   126 VLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSELVYEACMHTFDCLPLAALLNQQ 190

  Fly   235 FLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYF 299
            |||:|||:||||..||||:.|:||.||||:||:|||||||||||:|:|||.|.::||:|||||||
  Rat   191 FLCVHGGMSPEITCLDDIRKLDRFAEPPAFGPVCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYF 255

  Fly   300 FSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKY 364
            |||.|.|||||.|:||||:|||||||||||||||||.||||||||||||||||||||||||||||
  Rat   256 FSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAVLKY 320

  Fly   365 ENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELVAGPDDELEEEL 429
            ||||||||||||||||||||||||||||||||||||||||||||||||||:|:     ..:||| 
  Rat   321 ENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDEEM-----SLVEEE- 379

  Fly   430 RKKIVLVPANASNNNNNNNTPSKPASMSALRKEIIRNKIRAIGKMSRVFSILREESESVLQLKGL 494
                            ::...|.|...:::|||:|||||||||||:|||::||||||:||.||||
  Rat   380 ----------------DHYISSCPKGATSVRKEVIRNKIRAIGKMARVFTVLREESENVLILKGL 428

  Fly   495 TPTGALPVGALSGGRDSL----------KEALQGLTASSHIHSFAEAKGLDAVNERMPPRR 545
            ||||.||:|.||||:.::          :||::|.|.:..|.||.||:|||.:|||||||:
  Rat   429 TPTGTLPLGVLSGGKQTIETAKLQAAEEREAIRGFTIAHRIRSFEEARGLDRINERMPPRK 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 247/304 (81%)
PP2Ac 98..369 CDD:197547 223/271 (82%)
Ppp3ccXP_008769035.1 MPP_PP2B 37..341 CDD:277361 247/304 (81%)
PP2Ac 54..325 CDD:197547 223/271 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292850279
eggNOG 1 0.900 E1_COG0639
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D194337at33208
OrthoFinder 1 1.000 FOG0000536
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45673
Phylome 1 0.910 0.714 Consistency score
TreeFam 1 0.960
87.810

Return to query results.
Submit another query.