DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CanA1 and Ppp6c

Sequence 1:NP_001247378.2 Gene:CanA1 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_598273.2 Gene:Ppp6c RGDID:708460 Length:305 Species:Rattus norvegicus

Alignment Length:287 Identity:120/288 (42%)
Similarity:167/288 (58%) Gaps:29/288 (10%)


  Fly   111 LLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWS 175
            ||.||.|:..|..|:||||||||||:||.:||..||....|.|:|:||:|||||:|:|...||.:
  Rat    34 LLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLA 98

  Fly   176 LKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKY-SESIYDACMEAFDCLPLAALLNQQFLCIH 239
            ||..:|..::|||||||.|.:|:.:.|..||..|| :.:.:..|.:.||.|.:|||:::|.||:|
  Rat    99 LKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVH 163

  Fly   240 GGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSA 304
            |||||:|.|||.|:|:.|.:|.|..|..|||:|||| ||......       |.||..:.|....
  Rat   164 GGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDP-EDVDTWAI-------SPRGAGWLFGAKV 220

  Fly   305 CCEFLQKNNLLSIVRAHEAQDAGYR-MYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYEN-N 367
            ..||:..|||..|.|||:....||: |:.:       .|:|::|||||.....|.|:::.::: |
  Rat   221 TNEFVHINNLKLICRAHQLVHEGYKFMFDE-------KLVTVWSAPNYCYRCGNIASIMVFKDVN 278

  Fly   368 VMNIRQFNCSPH-----------PYWL 383
            ....:.|...|.           ||:|
  Rat   279 TREPKLFRAVPDSERVIPPRTTTPYFL 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 120/288 (42%)
PP2Ac 98..369 CDD:197547 115/261 (44%)
Ppp6cNP_598273.2 MPP_PP2A_PP4_PP6 5..289 CDD:277360 116/270 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.