| Sequence 1: | NP_001247378.2 | Gene: | CanA1 / 43670 | FlyBaseID: | FBgn0010015 | Length: | 622 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598273.2 | Gene: | Ppp6c / 171121 | RGDID: | 708460 | Length: | 305 | Species: | Rattus norvegicus |
| Alignment Length: | 287 | Identity: | 120/287 - (41%) |
|---|---|---|---|
| Similarity: | 167/287 - (58%) | Gaps: | 29/287 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 111 LLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWS 175
Fly 176 LKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKY-SESIYDACMEAFDCLPLAALLNQQFLCIH 239
Fly 240 GGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSA 304
Fly 305 CCEFLQKNNLLSIVRAHEAQDAGYR-MYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYEN-N 367
Fly 368 VMNIRQFNCSPH-----------PYWL 383 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CanA1 | NP_001247378.2 | MPP_PP2B | 81..385 | CDD:277361 | 120/287 (42%) |
| PP2Ac | 98..369 | CDD:197547 | 115/260 (44%) | ||
| Ppp6c | NP_598273.2 | MPP_PP2A_PP4_PP6 | 5..289 | CDD:277360 | 116/269 (43%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0639 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53795 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.820 | |||||