DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and COPT1

DIOPT Version :8

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_200711.1 Gene:COPT1 / 836020 AraportID:AT5G59030 Length:170 Species:Arabidopsis thaliana

Alignment Length:248 Identity:53/249 (21%)
Similarity:80/249 (32%) Gaps:108/249 (43%)


  Fly    15 HHASHGSPEPVPPSSGHEGHHSP-EMNHHGNHGEHTKHGHHEGGAH---DMSMAMFFHTGDSETI 75
            |...||.|.|...||.     || .|.::|:        .:|||.|   .|.|.|.|..|.:..:
plant     3 HDHMHGMPRPSSSSSS-----SPSSMMNNGS--------MNEGGGHHHMKMMMHMTFFWGKNTEV 54

  Fly    76 LFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQYNRPRRYREANYNY 140
            ||..|...|:....|..:.:|.:|||       .|||                            
plant    55 LFSGWPGTSSGMYALCLIFVFFLAVL-------TEWL---------------------------- 84

  Fly   141 NQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHHHVQENTPPAGRTT 205
                                                   |.|||:               .|.|.
plant    85 ---------------------------------------AHSSLL---------------RGSTG 95

  Fly   206 KLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYIF 258
            ......:|  ::||.::.|::.:::|:||..|:||..:.:..|.|..||:.:|
plant    96 DSANRAAG--LIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLF 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453 8/34 (24%)
Ctr 63..258 CDD:282057 36/195 (18%)
COPT1NP_200711.1 Ctr 45..146 CDD:282057 34/192 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2386
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.