DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and F58G6.9

DIOPT Version :8

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001023247.1 Gene:F58G6.9 / 3565521 WormBaseID:WBGene00044107 Length:156 Species:Caenorhabditis elegans

Alignment Length:201 Identity:44/202 (22%)
Similarity:81/202 (40%) Gaps:69/202 (34%)


  Fly    63 MAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQY 127
            |.|::|....:|:|||.|....|..:..:|.::....:|.||||:.| |. :.:|.::    ||.
 Worm    21 MWMWYHVDVEDTVLFKSWTVFDAGTMVWTCFVVAAAGILLEALKYAR-WA-TEERMKI----DQE 79

  Fly   128 NRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHH 192
            |...:                 .:..|.::               ||:|.               
 Worm    80 NVDSK-----------------TKYGGIKI---------------PGKSE--------------- 97

  Fly   193 HVQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYI 257
                           |......||:.:..|..|:|::::||.|:|.|:|::|:::..|..:|:::
 Worm    98 ---------------KYNFWKRHIIDSLYHFWQLLLAYILMNVYMVFSVYICLSLCFGLAIGHFV 147

  Fly   258 FCAFRT 263
            | |.||
 Worm   148 F-ASRT 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453
Ctr 63..258 CDD:282057 40/195 (21%)
F58G6.9NP_001023247.1 Ctr 21..148 CDD:282057 40/195 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.