DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and Slc31a1

DIOPT Version :8

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_780299.2 Gene:Slc31a1 / 20529 MGIID:1333843 Length:196 Species:Mus musculus

Alignment Length:275 Identity:74/276 (27%)
Similarity:110/276 (40%) Gaps:84/276 (30%)


  Fly     1 MDHHGVDASEGHVHHHASHGSPE-PVPPSSGHEGHHSPEMNHHGNHGEHTKHGHHEGGAHDMSMA 64
            |:|.|::..|.|.|...:|.... .:||      ||.|..:...:||         ||...|.|.
Mouse     1 MNHMGMNHMEMHHHMGMNHTDDNITMPP------HHHPTTSASHSHG---------GGDSMMMMP 50

  Fly    65 M-FFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQYN 128
            | |:....:..:||......:...:..:.:.:|::|:.||.||..||.|.               
Mouse    51 MTFYFDFKNVNLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLL--------------- 100

  Fly   129 RPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHHH 193
               |..:.:..||                        |||...|.|          .:...||..
Mouse   101 ---RKSQVSIRYN------------------------SMPVPGPNG----------TILMETHKT 128

  Fly   194 VQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYIF 258
            |.:.            ..|..|:|||.||::||:||:.|||:|||:|.:||:||..|||.||::|
Mouse   129 VGQQ------------MLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLF 181

  Fly   259 C---AFRTNVQEHCN 270
            .   |...::.|||:
Mouse   182 SWKKAVVVDITEHCH 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453 7/34 (21%)
Ctr 63..258 CDD:282057 52/196 (27%)
Slc31a1NP_780299.2 Ctr 49..181 CDD:282057 52/196 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
87.840

Return to query results.
Submit another query.