DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and SLC31A1

DIOPT Version :8

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001850.1 Gene:SLC31A1 / 1317 HGNCID:11016 Length:190 Species:Homo sapiens

Alignment Length:268 Identity:71/269 (26%)
Similarity:105/269 (39%) Gaps:89/269 (33%)


  Fly    12 HVHHHA-----SHGSPEPVPPSSGHEGHHSPEMNHHGNHGEHTKHGHHEGGAHDMSMAMFFHTG- 70
            |.||..     |:.:.:|        .||.|..:        ..|.|..|.:..|.|.|.|:.| 
Human     3 HSHHMGMSYMDSNSTMQP--------SHHHPTTS--------ASHSHGGGDSSMMMMPMTFYFGF 51

  Fly    71 DSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQYNRPRRYRE 135
            .:..:||......:|..:..:.:.:|::|:.||.||..||.|.                  |..:
Human    52 KNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLL------------------RKSQ 98

  Fly   136 ANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHHHVQENTPP 200
            .:..||                        |||...|.|          .:...||..|.:.   
Human    99 VSIRYN------------------------SMPVPGPNG----------TILMETHKTVGQQ--- 126

  Fly   201 AGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYIFC---AFR 262
                     ..|..|:|||.||::||:||:.|||:|||:|.:||:||..|||.||::|.   |..
Human   127 ---------MLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVV 182

  Fly   263 TNVQEHCN 270
            .::.|||:
Human   183 VDITEHCH 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453 6/33 (18%)
Ctr 63..258 CDD:282057 54/196 (28%)
SLC31A1NP_001850.1 Ctr 45..175 CDD:309321 53/194 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.