DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15548 and CG9861

DIOPT Version :8

Sequence 1:NP_651836.2 Gene:CG15548 / 43667 FlyBaseID:FBgn0039812 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_611778.1 Gene:CG9861 / 37692 FlyBaseID:FBgn0034844 Length:898 Species:Drosophila melanogaster

Alignment Length:926 Identity:210/927 (23%)
Similarity:351/927 (38%) Gaps:239/927 (26%)


  Fly    35 WYRGLSQSQMAAANALFDILRENMDKNTTSNVAKLMVKLGLHPYPPWKTLHMVIKLSRGNDLAFL 99
            ||.|:|..|.|..:.:.:.||::.::.|...:.|.::.|||.|....|.:..:::|||.|.||||
  Fly    19 WYMGISAKQEATMSTMSESLRDDFEQGTGEKMFKALISLGLQPVISKKKISRIVQLSRNNILAFL 83

  Fly   100 WFLMEMCYKTPNHGETYSVNEQIIMTAIFRLDLFPTLRELDRWLPLPHSSQSDRDKADALRQRNQ 164
            :|:||..|||......||:|||::|.||.::|:.||:|.||..||.|...:.|        .:.|
  Fly    84 FFVMEGYYKTKQTDGVYSINEQLLMNAIAKIDMLPTIRALDIVLPQPPVKKPD--------PQTQ 140

  Fly   165 RLKKEKEDKRQRDLDRKAKIVKPLSPYFQEPNIPGKIRNERKLLSDYPDTAATLFHM-------- 221
            .|.....::.|:...:|       ||||...  |..::...:|.:..|:...: |:.        
  Fly   141 SLASLTTERPQKKPSKK-------SPYFLRQ--PKPVQRTSRLTAKIPEFVVS-FNFWPTNGPPE 195

  Fly   222 ----DEEPLEAYLWSRWFGTYTLNDAHRVGKSIIYEEINNIFESFKAASL----------PTRHV 272
                :|||        |:..|.||...|:.|..:.|.:...   ||.|::          .:|..
  Fly   196 YGTEEEEP--------WYALYRLNPGQRLIKKTLSETLERY---FKLAAVEGKQDAEETQQSREP 249

  Fly   273 E-SLCAHHQFIREMEKSLKDKLETMKRRKCEELIEAKNRLEERKRKRVIQELEEMSACYLKRFQE 336
            | ::|..|:......:.|:|:|....|.:|.||::......:.::.|::.:||.       ....
  Fly   250 EANMCLVHKGQVLQAQLLRDELAVKARDRCLELLDVNEPYAKLRKARIVAQLEH-------DIDV 307

  Fly   337 MAARARLASTSKQLFGGSSVKASYFDCPDNEIRCDDFDV-----------------EKC------ 378
            :.||.|.|....|.   ..:....|||    :.|....|                 |.|      
  Fly   308 IMARHRNAMHCDQT---KVLTIENFDC----VLCQQMLVSQPWPETKGQIGRALVGEDCTVAHTT 365

  Fly   379 --QTFEAERLTKNHIGDTPKSASG-----------NNIRLASGAQAKSKT-------RSRSR--- 420
              .|:..:||...  .:.||...|           ...||..||:....|       :.|.:   
  Fly   366 AFDTYRGKRLEGG--AEKPKKKDGTVARTSGIDTCRGKRLEGGAEKTDSTVPQPPAEKGRGKRLK 428

  Fly   421 ---SRSKSRRSRKPQSKARSI-------KEPEVLVETPVLPP---------RTAKEDFRDIT--- 463
               .:.|..:..|.:.||:.:       |:|:|   :|..||         |....||.:.|   
  Fly   429 GGGGKPKKDKKGKKEKKAKVVEPEPENPKKPKV---SPWKPPPRKLVSGPFRIHNIDFNEYTQVC 490

  Fly   464 ---IRLLEGENP-----------ILKG--------CPALQLESPHCAKCLIFDPQKGLPQKPQKK 506
               :...|.|.|           :.||        |......:.|........|:...|.: .|.
  Fly   491 TQVVGPSECELPPAPKKSAVSFILAKGKIEGNAHKCDMRMPNNRHVKTRFFRGPRSNKPYQ-FKY 554

  Fly   507 HR--------PSSLMQFLQNC------PSEGNEEE-------------------DSHNE--MAAN 536
            ||        |..|...:...      .|:|:|.:                   ||.:|  ....
  Fly   555 HRVFQSGQPKPFDLSHIMAKSFVKALDQSDGDEADPCYFRELLSEMVIEDEAPPDSKSEGLPETE 619

  Fly   537 PSAHSVQ--EPKLFDLGLLGRNCARFNYRELFGSLQRTHLDDERMRLKEAFVRAIDDDVQYLSAA 599
            |...|.|  :|.|                |:|..|.:|.:.|.|..|..:...:....|.|.:..
  Fly   620 PEKKSKQDSQPPL----------------EIFSDLDQTRISDSRETLDRSSNHSGRSHVNYKAEI 668

  Fly   600 LSGEEEGSLDALVDRAAKRVFAQDVKAFHEELEKMHKQ--KAAKKYKSDSRLNFGQEFYDPENIP 662
                    :||:| |.||.|:.:.......|:|:|.:.  :.|..:|.       .|.:||.:..
  Fly   669 --------VDAVV-RCAKAVWQKRTLIKRAEMERMGRMTPRKALTHKD-------TESFDPNDAA 717

  Fly   663 LMKEMLRLGLEKVAQDKRYVLPTLPDVHSVPYLIEWIRLRYGKRYSYGEKEQILNRDKLVMDQIT 727
            .|.::|:.|:..:.::.||||..|||.|.:|.|.||::.||||.||..|.|:.:.....:.:.:|
  Fly   718 QMDKLLKDGMRVLRKEPRYVLACLPDAHKLPVLREWVKRRYGKTYSQKELEESIAESSRIFELVT 782

  Fly   728 WMMHT----NLAKIPALPIG-DNFTDMTKLRELTKKFRERHTNKFLEAIMEVERVFYSAMKPHLC 787
            .:..:    :|..|..||.. :||....:::......::.:.::.....:.:....:.||..:|.
  Fly   783 ILQSSPASPDLMGIDRLPRSKENFNFYKQIKNTAALAKQTYHDQLNARYLSIVSSAWYAMGNYLV 847

  Fly   788 -NLATEETFLAYLPAH 802
             .....:||.||:.::
  Fly   848 PGGPPRKTFFAYIASN 863

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15548NP_651836.2 DUF4770 70..248 CDD:292613 57/190 (30%)
DUF4771 654..806 CDD:292614 40/156 (26%)
CG9861NP_611778.1 DUF4770 54..218 CDD:292613 57/190 (30%)
DUF4771 709..867 CDD:292614 40/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9W7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR41967
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.