DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15548 and CG13127

DIOPT Version :8

Sequence 1:NP_651836.2 Gene:CG15548 / 43667 FlyBaseID:FBgn0039812 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_609338.1 Gene:CG13127 / 34335 FlyBaseID:FBgn0032176 Length:734 Species:Drosophila melanogaster

Alignment Length:870 Identity:190/871 (22%)
Similarity:333/871 (38%) Gaps:256/871 (29%)


  Fly    25 GYKAAERRVSWYRGLSQSQMAAANALFDILRENMDKNTTSNVAKLMVKLGLHPYPPWKTLHMVIK 89
            |::.....|.||||:|..||.|.:.|...||::|::.:|..|...:.:||::|......:..:|.
  Fly     7 GFRHNIDSVRWYRGMSVVQMKACDELLHALRDDMEQGSTYRVRHCITQLGIYPPVGAAQIKDIIA 71

  Fly    90 LSRGNDLAFLWFLMEMCYKTP---------NHGETYSVNEQIIMTAIFRLDLFPTLRELDRWLPL 145
            :|:|:||||||||.|..||:|         :..|.::||||::::.|..||:..|||.||..  |
  Fly    72 MSQGSDLAFLWFLWEFAYKSPPKCGKDNCNSDSEHFTVNEQLLLSGIAHLDMPSTLRALDAL--L 134

  Fly   146 PHSSQSDRDKADALRQRNQRLKKEKEDK--RQR-----DLDRKAKIVKPLSPY-----FQEPNIP 198
            |.::||        ::.|.::|.|::..  |:|     ||...|.:|:| ..|     |:.|   
  Fly   135 PPATQS--------KKLNSQIKTEQKSSIPRRRKPKNYDLPYFAPLVRP-REYIPKCKFRPP--- 187

  Fly   199 GKIRNERKLLSDYPDTAATLFHMDEEPLEAYLWSRWFGTYTLNDAHRVGKSIIYEEINNI---FE 260
                 |.|||  :|:.:..:..|.:.|.|.   ||||..|.|..|.||...::.:::|.|   ::
  Fly   188 -----ETKLL--FPEYSHYIDRMKQIPNEG---SRWFAQYKLCPAKRVVNKLLRDQLNGISLKWD 242

  Fly   261 SFKAASLPTRHVESLCAHHQFIREMEKSLKDKLETMKRRKCEELIEAKNRLEERKRKRVIQELEE 325
            .....:.|      :|..|:|::::|.  ..|.|.:.::.|..:::......:.:||.::.::|.
  Fly   243 DNLEDNAP------VCETHRFLKKVEN--LQKQEKILKQPCVTMLDVVGDELKARRKHILNDIEN 299

  Fly   326 MSACYLKRFQEM-------------AARARLASTSKQLFG-GSSVKA---SYFDCPDNEIR---- 369
            ......||....             :..||.......|.| |:....   ||....:|.||    
  Fly   300 NVKWASKRMNRQLGITSGPGKLPKGSCTARKKKEPTILIGLGNEENLRLHSYAHSLNNSIRVMLM 364

  Fly   370 ------------CDDFDVEKCQTFEAERLT------KNHIGDTPKSASGNNIRLASGAQAKSKTR 416
                        |...||: |:...:..:|      |:.|.:.|:..:.:..:||......|:| 
  Fly   365 KGNESHRCGAGDCKILDVD-CEMKGSAEITMKPQNVKSFIEEKPRLPTSSFKKLADLIPVCSRT- 427

  Fly   417 SRSRSRSKSRRSRKPQSKARSIKEPEV------LVETPVLPPRTAKEDFRDITIRLLEGENPILK 475
            .||..||..:...:.....|||...::      .|.:|.:.|...:|:..|     ||.:.|:::
  Fly   428 LRSLKRSSPKAPAEESFTNRSIGGFQLDYHKIFDVPSPPVEPLPWEEEVLD-----LEDKQPVIE 487

  Fly   476 GCPALQLESPHCAKCLIFDPQKGLPQKPQKKHRPSSLMQFLQNCPSEGNEEEDSHNEMAANPSAH 540
            ..         |...|                               ||::..|..|:..|.|  
  Fly   488 RL---------CIDAL-------------------------------GNDDNKSKKELLRNKS-- 510

  Fly   541 SVQEPKLFDLGLLGRNCARFNYRELFGSLQRTHLDDERMRLKEAFVRAIDDDVQYLSAALSGEEE 605
                                                                             
  Fly   511 ----------------------------------------------------------------- 510

  Fly   606 GSLDALVDRAAKRVFAQDVKAFHEELEKMHKQKAAKKYKSDSRLNFGQEFYDPENIPLMKEMLRL 670
               :.:|.|:|.:.   .|..|..:|.:..:.:..|..|.:     |....||::...::.:|:.
  Fly   511 ---NPVVSRSAAKC---AVNMFRSKLAENAENQDDKHIKQN-----GDILIDPDDDEQIESLLKE 564

  Fly   671 GLEKVAQDKRYVLPTLPDVHSVPYLIEWIRLRYGKRYSYG-----------------EKEQILNR 718
            .|..:..:::|||.||.:.|.:|.|::|:..||||.|...                 |||:...|
  Fly   565 ALRVLRGNRQYVLATLSNAHKMPVLLDWVADRYGKSYCRAGMKSIVKTSFRIYEKVYEKERRNKR 629

  Fly   719 DKLVMDQITWMMHTNLAKIPALPIGDNFTDMTKLRELTKKFRERHTNKFLEAIMEVERVFYSAMK 783
            :.|.:.:          .:..|....::....|......:.:..:.||..|..:|..|:.:.|::
  Fly   630 NMLELKR----------SVTGLGSSISYASHKKFMSQVVQRKAEYNNKLNELALEQSRLTWLALR 684

  Fly   784 --PHLCNLATEETFLAYLPAHFHDL 806
              .||.. :.::||.||:||...|:
  Fly   685 GYSHLGG-SIKDTFFAYMPARPQDI 708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15548NP_651836.2 DUF4770 70..248 CDD:292613 65/199 (33%)
DUF4771 654..806 CDD:292614 40/171 (23%)
CG13127NP_609338.1 DUF4770 52..226 CDD:292613 65/198 (33%)
DUF4771 550..708 CDD:292614 40/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9W7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR41967
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.