DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr2f5

DIOPT Version :10

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002938509.1 Gene:nr2f5 / 100491959 XenbaseID:XB-GENE-486334 Length:398 Species:Xenopus tropicalis


Alignment Length:88 Identity:19/88 - (21%)
Similarity:38/88 - (43%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LAYSTVVAAAPALVAQKEISYQKSIVEEPTVAHVGTIEKSVPTGYSHQSFTQYHNKQVAEPV--- 89
            |.:.::....|.:|:.|:  |..:...:..:...|..::.   |.|..:..| .|..:.:.:   
 Frog    65 LQHGSLFLRTPKIVSGKD--YNVTANSKLVIITAGARQQE---GESRLNLVQ-RNVNIFKFIIPN 123

  Fly    90 ---FAPAVKKTVVSTPVEKTTYV 109
               ::|..|..:||.||:..|||
 Frog   124 VVKYSPNCKLLIVSNPVDILTYV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 19/88 (22%)
NR_LBD 215..436 CDD:472173
nr2f5XP_002938509.1 NR_DBD_COUP_TF 63..135 CDD:143516 12/75 (16%)
NR_LBD_COUP-TF 161..397 CDD:132746
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.