DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dj-1beta and HSP33

Sequence 1:NP_651825.4 Gene:dj-1beta FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_015036.3 Gene:HSP33 SGDID:S000005918 Length:237 Species:Saccharomyces cerevisiae

Alignment Length:238 Identity:49/239 (21%)
Similarity:80/239 (33%) Gaps:77/239 (32%)


  Fly     3 KSALVILA--------PGAEEMEFII----AADVLRRAGIKVTVAGLNGGEAVKCSRDVQILP-- 53
            |.||:.|.        .||:...|::    :.|...:.|.:|......||    ...|...||  
Yeast     4 KRALISLTSYHGPFYKDGAKTGVFVVEILRSFDTFEKHGFEVDFVSETGG----FGWDEHYLPKS 64

  Fly    54 -----------------DTSLAQV-------ASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQE 94
                             :.:||::       ||| :.|.....|.|......::..:.|:.....
Yeast    65 FIGGEDKMNFETKNSAFNKALARIKTANEVNASD-YKVFFASAGHGALFDYPKAKNLQDIASKIY 128

  Fly    95 SGGGLIAAICAAP-------TVLAKHGVASGKSLTSYP--------------SMKPQLV------ 132
            :.||:|||||..|       .:.....:..||::|.:|              |.|...|      
Yeast   129 ANGGVIAAICHGPLLFDGLIDIKTTRPLIEGKAITGFPLEGEIALGVDDILRSRKLTTVERVANK 193

  Fly   133 NNYSYV------DDKTVVKDGNLITSRGPGTAYEFALKIAEEL 169
            |...|:      ||.::. ||.|:|.....::|...::....|
Yeast   194 NGAKYLAPIHPWDDYSIT-DGKLVTGVNANSSYSTTIRAINAL 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 48/238 (20%)
HSP33NP_015036.3 GAT_1 5..235 CDD:320716 47/236 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.