DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dj-1beta and DJ1B

Sequence 1:NP_651825.4 Gene:dj-1beta FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_564626.1 Gene:DJ1B AraportID:AT1G53280 Length:438 Species:Arabidopsis thaliana

Alignment Length:180 Identity:76/181 (42%)
Similarity:111/181 (61%) Gaps:3/181 (2%)


  Fly     6 LVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVL 70
            ||.:|.|:||||.:...|||:||...|.||.|.....|..||.|:::.|..|.:...:.:|::||
plant   261 LVPIADGSEEMEAVAIIDVLKRAKANVVVAALGNSLEVVASRKVKLVADVLLDEAEKNSYDLIVL 325

  Fly    71 PGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPT-VLAKHGVASGKSLTSYPSMKPQLVNN 134
            ||||||:.|...|..:.::|:.|........||||:|. |...||:..||..|::|:|..:|.:.
plant   326 PGGLGGAEAFASSEKLVNMLKKQAESNKPYGAICASPALVFEPHGLLKGKKATAFPAMCSKLTDQ 390

  Fly   135 YSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLV 184
             |:::.:.:| ||||||||||||:.||||.|.|:..|:||..:::|..||
plant   391 -SHIEHRVLV-DGNLITSRGPGTSLEFALAIVEKFYGREKGLQLSKATLV 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 74/176 (42%)
DJ1BNP_564626.1 not_thiJ 54..231 CDD:213612
GATase1_DJ-1 55..219 CDD:153229
not_thiJ 260..435 CDD:213612 74/176 (42%)
GATase1_DJ-1 260..423 CDD:153229 70/164 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H38295
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32178
orthoMCL 1 0.900 OOG5_127669
Panther 1 1.100 O PTHR43444
Phylome 1 0.910 0.667 Consistency score
54.910

Return to query results.
Submit another query.