DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dj-1beta and DJ1C

Sequence 1:NP_651825.4 Gene:dj-1beta FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_195128.2 Gene:DJ1C AraportID:AT4G34020 Length:472 Species:Arabidopsis thaliana

Alignment Length:181 Identity:63/182 (35%)
Similarity:102/182 (56%) Gaps:1/182 (1%)


  Fly     6 LVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVL 70
            |:.:|.|:|.:|.:..|||||||.:.|||:.:.....:...:..:|:.|..:.:.|...:|:::|
plant   290 LIPVANGSEAVELVSIADVLRRAKVDVTVSSVERSLRITAFQGTKIITDKLIGEAAESSYDLIIL 354

  Fly    71 PGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVNNY 135
            |||..||..:.:|.::..|||.|...|.:..|..::.|||.|||:...|..|.|||...:.:|. 
plant   355 PGGHTGSERLQKSKILKKLLREQHESGRIYGATNSSSTVLHKHGLLKEKRTTVYPSESDEPMNQ- 418

  Fly   136 SYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLVAY 186
            ..::...||.|||:|||.|..|..:|:|.|..:|.|..:.:.|::||:..|
plant   419 QMIEGAEVVIDGNVITSLGLATVTKFSLAIVSKLFGHARARSVSEGLVHEY 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 60/175 (34%)
DJ1CNP_195128.2 DJ-1_PfpI 84..248 CDD:280192
not_thiJ 85..258 CDD:213612
not_thiJ 288..464 CDD:213612 60/175 (34%)
GATase1_DJ-1 289..452 CDD:153229 57/163 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32178
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43444
Phylome 1 0.910 0.667 Consistency score
33.010

Return to query results.
Submit another query.