DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dj-1beta and park7

Sequence 1:NP_651825.4 Gene:dj-1beta FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001005938.1 Gene:park7 ZFINID:ZDB-GENE-041010-5 Length:189 Species:Danio rerio

Alignment Length:185 Identity:99/186 (53%)
Similarity:128/186 (69%) Gaps:4/186 (2%)


  Fly     3 KSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQV-ASDKFD 66
            |.||||||.||||||.:|..||:|||||.||||||.|.|.|:|||:|.|.||:||... ....:|
Zfish     4 KRALVILAKGAEEMETVIPVDVMRRAGIAVTVAGLAGKEPVQCSREVMICPDSSLEDAHKQGPYD 68

  Fly    67 VVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQL 131
            ||:|||||.|:..:.||..|.::|:.||...||||||||.||.|..||:|.|.::|::|..|.::
Zfish    69 VVLLPGGLLGAQNLSESPAVKEVLKDQEGRKGLIAAICAGPTALLAHGIAYGSTVTTHPGAKDKM 133

  Fly   132 V--NNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLV 184
            :  ::|.| .:..|.||||:||||||||::||||.|.|||.|.|...:|...|::
Zfish   134 MAGDHYKY-SEARVQKDGNVITSRGPGTSFEFALTIVEELMGAEVAAQVKAPLIL 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 97/180 (54%)
park7NP_001005938.1 not_thiJ 5..184 CDD:213612 97/180 (54%)
GATase1_DJ-1 6..172 CDD:153229 93/167 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171454577
eggNOG 1 0.900 E1_COG0693
Hieranoid 1 1.000
Homologene 1 1.000 H38295
Inparanoid 1 1.050 193 1.000 Inparanoid score I3768
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003433
OrthoInspector 1 1.000 T595944
orthoMCL 1 0.900 OOG5_127669
Panther 1 1.100 O PTHR43444
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1763
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.