DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dj-1beta and SPAC22E12.03c

Sequence 1:NP_651825.4 Gene:dj-1beta FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_594829.1 Gene:SPAC22E12.03c PomBaseID:SPAC22E12.03c Length:191 Species:Schizosaccharomyces pombe

Alignment Length:185 Identity:61/186 (33%)
Similarity:99/186 (53%) Gaps:11/186 (6%)


  Fly     7 VILAPGAEEMEFIIAADVLRRAGIKV--TVAGLNGGEAVKCSRDVQILPDTSLAQVAS-----DK 64
            :.:|.|.:|:||.....:.:||.|.:  ...|.|....||.||||::..:.|..::.|     .:
pombe     6 LFVADGTDEIEFSAPWGIFKRAEIPIDSVYVGENKDRLVKMSRDVEMYANRSYKEIPSADDFAKQ 70

  Fly    65 FDVVVLPGGLGGSNAMGESSLVGDLLRS-QESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMK 128
            :|:.::|||..|:..:..:..|..:::. .:.....|..|||. |:.||......|.:|.:||::
pombe    71 YDIAIIPGGGLGAKTLSTTPFVQQVVKEFYKKPNKWIGMICAG-TLTAKTSGLPNKQITGHPSVR 134

  Fly   129 PQL-VNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGL 182
            .|| ...|.|:|...|::: |||||:|||||..|.||:.|::|.|:|...|.|.|
pombe   135 GQLEEGGYKYLDQPVVLEE-NLITSQGPGTAMLFGLKLLEQVASKDKYNAVYKSL 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 60/183 (33%)
SPAC22E12.03cNP_594829.1 DJ-1_PfpI 2..174 CDD:280192 55/170 (32%)
not_thiJ 3..186 CDD:213612 59/182 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H38295
Inparanoid 1 1.050 92 1.000 Inparanoid score I1700
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003433
OrthoInspector 1 1.000 T631372
orthoMCL 1 0.900 OOG5_127669
Panther 1 1.100 O PTHR43444
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1763
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.