DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dj-1beta and SPAC1F7.06

Sequence 1:NP_651825.4 Gene:dj-1beta FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_594492.1 Gene:SPAC1F7.06 PomBaseID:SPAC1F7.06 Length:251 Species:Schizosaccharomyces pombe

Alignment Length:206 Identity:46/207 (22%)
Similarity:74/207 (36%) Gaps:53/207 (26%)


  Fly    12 GAEEMEFIIAADVLRRAGIKVTVAGLNG--GEAVKCSRDVQIL---------PDTSLA------- 58
            |...::...|..|....|..:.:|...|  |...|..||..|:         ||.||.       
pombe    36 GVNVVDLYEAFKVFEENGFDIVIASDTGDYGFDDKSFRDPAIVDETQSIFSNPDCSLMKKLKNIA 100

  Fly    59 ---QVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKS 120
               ::....:.:|.:|||.|.|.....:.:|.|.|.......|:|.|:..|...||....:.|::
pombe   101 RLDRLNPSDYVIVYIPGGYGCSFDFPHAKVVQDFLYRFYETKGIICAVAQANIALAYTTNSDGQA 165

  Fly   121 LTSYP-----SMKPQL----------VNNYS-----------------YVDDKTVVKDGNLITSR 153
            |.:..     :.|.::          :|.||                 ||:|..:|:||.|.|..
pombe   166 LCTNRRVTGCTWKDEVQNGVLNVMNRLNFYSFGHIAENIGAIFESPPVYVEDPFIVEDGQLFTGS 230

  Fly   154 GPGTAYEFALK 164
            ...:|...|::
pombe   231 NTNSAKGVAME 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 46/207 (22%)
SPAC1F7.06NP_594492.1 GAT_1 16..246 CDD:294025 46/207 (22%)
ThiJ 34..251 CDD:223765 46/207 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43444
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.