DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj-1beta and SPBC947.09

DIOPT Version :9

Sequence 1:NP_651825.4 Gene:dj-1beta / 43652 FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_595267.1 Gene:SPBC947.09 / 2541295 PomBaseID:SPBC947.09 Length:261 Species:Schizosaccharomyces pombe


Alignment Length:165 Identity:37/165 - (22%)
Similarity:66/165 - (40%) Gaps:44/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NGGEAVKCSRDV---------QILPDTSLA-QVASDKFDVVVLPGGLGGSNAMGESSLVGDLLRS 92
            :|.|..|..:.|         :|:.::..| :|..||:|:..:.||........:::.:..|..|
pombe    86 SGPELSKAEKYVLENKDDMFWRIVQNSKTADEVNPDKYDIFFVAGGHATLFDFPKATNLQKLGTS 150

  Fly    93 QESGGGLIAAICAAPTVL---------AKHGVASGKSLTSYPSM---KPQLVN-----NYSYVDD 140
            ....||::||:|..||:|         ....:..||.:|::..:   |.:|:.     |...:||
pombe   151 IYENGGVVAAVCHGPTLLPFMKRQTSDGSVSIVCGKDVTAFDRVAEDKSKLMEALKKYNLEVLDD 215

  Fly   141 KT-----------------VVKDGNLITSRGPGTA 158
            ..                 |:.||.|:|...|.:|
pombe   216 MLNDAGANFIKSPNPFGDFVIADGRLVTGSNPASA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 37/165 (22%)
SPBC947.09NP_595267.1 GATase1_Ydr533c_like 7..261 CDD:153241 37/165 (22%)
ThiJ 18..261 CDD:223765 37/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.