DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dj-1beta and djr-1.2

Sequence 1:NP_651825.4 Gene:dj-1beta FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_504132.1 Gene:djr-1.2 WormBaseID:WBGene00016789 Length:186 Species:Caenorhabditis elegans

Alignment Length:184 Identity:83/185 (45%)
Similarity:116/185 (63%) Gaps:4/185 (2%)


  Fly     3 KSALVILAP-GAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFD 66
            ||||::|.| .|||:|.|:..|||.|.|::|..|| :..|.|||::..:|:||.:|..|.:..||
 Worm     5 KSALILLPPEDAEEIEVIVTGDVLVRGGLQVLYAG-SSTEPVKCAKGARIVPDVALKDVKNKTFD 68

  Fly    67 VVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQL 131
            ::::|||.|.|. :.|..::|:||::|...||||.||||.||||..||:.:.:....|.......
 Worm    69 IIIIPGGPGCSK-LAECPVIGELLKTQVKSGGLIGAICAGPTVLLAHGIVAERVTCHYTVKDKMT 132

  Fly   132 VNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLVA 185
            ...|.|:||..|:.| .:|||:|||||:||||||.|.|.|.||...:.|.|.:|
 Worm   133 EGGYKYLDDNVVISD-RVITSKGPGTAFEFALKIVETLEGPEKTNSLLKPLCLA 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 80/178 (45%)
djr-1.2NP_504132.1 DJ-1_PfpI 5..167 CDD:280192 75/165 (45%)
not_thiJ 6..181 CDD:213612 80/178 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171453051
eggNOG 1 0.900 E1_COG0693
Hieranoid 1 1.000
Homologene 1 1.000 H38295
Inparanoid 1 1.050 182 1.000 Inparanoid score I2603
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003433
OrthoInspector 1 1.000 T98030
orthoMCL 1 0.900 OOG5_127669
Panther 1 1.100 O PTHR43444
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.