DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dj-1beta and PARK7

Sequence 1:NP_651825.4 Gene:dj-1beta FlyBaseID:FBgn0039802 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001116849.1 Gene:PARK7 HGNCID:16369 Length:189 Species:Homo sapiens

Alignment Length:186 Identity:98/187 (52%)
Similarity:130/187 (70%) Gaps:4/187 (2%)


  Fly     2 SKSALVILAPGAEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASD-KF 65
            ||.||||||.||||||.:|..||:||||||||||||.|.:.|:|||||.|.||.||.....: .:
Human     3 SKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPY 67

  Fly    66 DVVVLPGGLGGSNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQ 130
            ||||||||..|:..:.||:.|.::|:.||:..||||||||.||.|..|.:..|..:|::|..|.:
Human    68 DVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDK 132

  Fly   131 LVN--NYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLLV 184
            ::|  :|:|.::: |.|||.::|||||||::||||.|.|.|.|||...:|...|::
Human   133 MMNGGHYTYSENR-VEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVL 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dj-1betaNP_651825.4 not_thiJ 4..181 CDD:213612 95/180 (53%)
PARK7NP_001116849.1 not_thiJ 5..184 CDD:213612 95/180 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171456345
eggNOG 1 0.900 E1_COG0693
Hieranoid 1 1.000
Homologene 1 1.000 H38295
Inparanoid 1 1.050 181 1.000 Inparanoid score I3928
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003433
OrthoInspector 1 1.000 T608442
orthoMCL 1 0.900 OOG5_127669
Panther 1 1.100 O PTHR43444
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1763
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.