DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and STE20

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_011856.1 Gene:STE20 SGDID:S000000999 Length:939 Species:Saccharomyces cerevisiae

Alignment Length:1153 Identity:238/1154 (21%)
Similarity:383/1154 (33%) Gaps:384/1154 (33%)


  Fly    86 PPAIVGQPGAGSI----------SVSGVGVGVVGVANGRVPKMMTALMPNKLIRKPSIERDTASS 140
            |.|:...|...|:          ::.|.|.|..|:   |:|:....|..|      ::::.|.::
Yeast     5 PSAVSELPDKDSLDNGISNDNERAMGGNGDGGDGL---RLPRTTGTLNVN------ALQKGTNAA 60

  Fly   141 H----YLRCSPA---------------LDSG------------AGSSRSDSPHSHHTHQPSSRTV 174
            |    |....||               ||..            :|.|.|.||||:.....|...|
Yeast    61 HEAGGYKSMDPAKNAETTNDDDNNVVSLDDPIQFTRVSSSSVISGMSSSMSPHSNIDETKSLEAV 125

  Fly   175 GNPGGNGGFSPSPSG---FSEV-APPAPPPRNPTACSAATPPPPVPP-TSQAYVKRRSPALNNRP 234
            .........:|..|.   ||.: |..:....|.|..|..:....... .:.|.||.:.|      
Yeast   126 TPNINTSNITPDHSADNTFSTINASESDHQFNDTLLSKLSLTDSTETIENNATVKHQQP------ 184

  Fly   235 PAIAPPTQRGN-------------SPVITQNGLKNPQQQLTQQLKSLNLYPGGGSGAVVEPPPPY 286
              :|..|...|             :|||::..:....:|:.....||:..........|:|..| 
Yeast   185 --VASSTVNSNKSSTDIRRATPVSTPVISKPSMTTTPRQINSASHSLSNPKHKQHKPKVKPSKP- 246

  Fly   287 LIQGGAGGAAPPPPPPSYTASMQSR-----QSPTQSQ-QSDYRKSPSSGIYSATSAGSPSPITVS 345
                     .....|.|...|..|:     .||.:.| :..|..|.|....|.:::|:       
Yeast   247 ---------EAKSKPVSVKKSFPSKNPLKNSSPPKKQTEKSYYSSSSKKRKSGSNSGT------- 295

  Fly   346 LPPAPLAKPQPRVYQARSQQPIIMQSVKSTQVQ--KPVLQTAVAPQSPSSASASNSPVHVLAAPP 408
                                 :.|:.|.::.||  |...|......|.|:.|:|:|....|....
Yeast   296 ---------------------LRMKDVFTSFVQNIKRNSQDDKRASSSSNNSSSSSITTALRIST 339

  Fly   409 SYPQKSAAVVQQQQQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLE--PPSYAKSMQAKA 471
            .|..|                   |.|.            ||::||.....  |..:.|.:.:..
Yeast   340 PYNAK-------------------HIHH------------VGVDSKTGEYTGLPEEWEKLLTSSG 373

  Fly   472 ATVVQQQQQQQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLA 536
            .:..:|||..|.....|:..|                          |..|.:..::........
Yeast   374 ISKREQQQNMQAVMDIVKFYQ--------------------------DVTETNGEDKMFKTFNTT 412

  Fly   537 NGNPGRQMLPPPPYQSNNNNNSEIKPPSCNNNNIQISN-----SNLATTPPIPPAKYNNNSSNTG 596
            .|.||...:..||..|.|.     .|||.::::...|.     ||...:|.:          ||.
Yeast   413 TGLPGSPQVSTPPANSFNK-----FPPSTSDSHNYGSRTGTPMSNHVMSPTL----------NTD 462

  Fly   597 ANSSGG----SNGSTGTTASSSTSCKKIK--------HASPI-------------PERKKISKEK 636
            ::|:.|    |..:....:|:|.|...||        :.||:             |.|..||:..
Yeast   463 SSSANGKFIPSRPAPKPPSSASASAPIIKSPVMNSAANVSPLKQTHAPTTPNRTSPNRSSISRNA 527

  Fly   637 EEERKEFRIRQYSPQAFK-------FFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIE 694
            ..:::|..:....|...|       ....|.:....|:..|.|            |..|.....:
Yeast   528 TLKKEEQPLPPIPPTKSKTSPIISTAHTPQQVAQSPKAPAQET------------VTTPTSKPAQ 580

  Fly   695 MR---KMLNQKESNYIRLKRAKMDKSMFVKLK----------------PIGVGAFGEVTLVSKID 740
            .|   |.||:|:    |.:|.:..|.::.||.                .||.||.|.|....:|.
Yeast   581 ARSLSKELNEKK----REERERRKKQLYAKLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIG 641

  Fly   741 TSNHLYAMKTLRKADVLKR----NQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIP 801
            | |...|:|.:......|:    |::..:|..:       :..:|....|:..|.:|:.:|:|:.
Yeast   642 T-NVSVAIKQMNLEKQPKKELIINEILVMKGSK-------HPNIVNFIDSYVLKGDLWVIMEYME 698

  Fly   802 GGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCT 866
            ||.|..::....:.|.::.. ...|....::.:|..|.:|||||.||||:..:|.|||||||.|.
Yeast   699 GGSLTDVVTHCILTEGQIGA-VCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCA 762

  Fly   867 GFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPE 931
                                       :.:|...|.|                ::||||.::|||
Yeast   763 ---------------------------QINELNLKRT----------------TMVGTPYWMAPE 784

  Fly   932 VLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPL---------------------ETQQKVIN 975
            |:.|..|....|.||:|:::.||:.|:||:|..:||                     .:.:|.::
Yeast   785 VVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLD 849

  Fly   976 WEKTLHIPPQAELSREATDLIRRLCASADKRLGKSVDEVKSHDFFKGIDFADMRKQKAPYI--PE 1038
            |  .|.:.|:...|  ||:|:                    ||.:. .:.|:.....||.:  ..
Yeast   850 W--CLCVEPEDRAS--ATELL--------------------HDEYI-TEIAEANSSLAPLVKLAR 889

  Fly  1039 IKH-----PTDTSNFDPVDPEKLR-------SNDSTMSSGDDVDQNDR 1074
            :|.     ..|..|.|..|.|.:.       :|||..:...||.::|:
Yeast   890 LKKVAENMDADEDNDDDNDNEHINKTNNCDDNNDSKETVNLDVTEDDK 937

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 97/414 (23%)
S_TKc 719..1020 CDD:214567 82/342 (24%)
STE20NP_011856.1 PBD 336..391 CDD:279166 15/86 (17%)
STKc_PAK 619..872 CDD:270789 80/330 (24%)
Pkinase 620..871 CDD:278497 80/327 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.