DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and AT1G48490

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001323023.1 Gene:AT1G48490 AraportID:AT1G48490 Length:1236 Species:Arabidopsis thaliana

Alignment Length:1311 Identity:306/1312 (23%)
Similarity:491/1312 (37%) Gaps:396/1312 (30%)


  Fly     6 EKRGGRPNDKYTAEALES---IKQDLTRFEVQNNHRNNQNYTPLRYTATNGRNDALTPDYH---- 63
            :.|...|:...:..::.|   |:.|..: ...|:....::....::.:..|:..:|  :.|    
plant    13 KSRSSSPSSSNSPRSVGSDSPIRSDKKK-PKSNSKEETRSPNTKKHVSAKGKEASL--EVHSSSP 74

  Fly    64 ----------HAKQPMEPPPSASPAPDVVIPPPPAIVGQPGAGSISVSGVGVGVVGVANGRVPKM 118
                      .||:|:...|:.|   ||....|.::      ..|..|.:|:..:...:|.:|:.
plant    75 GKSNSSSSGSEAKKPITETPATS---DVKEESPASV------SPIMASSLGLNRIKTRSGPLPQE 130

  Fly   119 MTALMPNKLIRKPSIERDTASSHYLRC--SPALDSG---AGSSRSDSPHSHHTHQPSSRTVG--- 175
            ...          |.|.|.|.. .|.|  ...||:|   ||||:.|              :|   
plant   131 SFF----------SFENDYAIP-VLPCYKLSKLDTGKKEAGSSKVD--------------IGPLR 170

  Fly   176 --NP-----GGNGGFSPSPS-----GFSEVAPP-----------APPPRNPTACSAATPPPPVPP 217
              ||     |..|.|..||:     |.:||..|           :..||........:.|....|
plant   171 SSNPALLASGTAGQFKVSPTISGPEGSAEVCTPENSYDLDDPKESDSPRYQALLRMTSAPRKRFP 235

  Fly   218 TSQAYVKRRSPALNN---RPPAIAPPTQRGNSPVITQNGLKNPQQQLTQQLKSLNLYPGGG---- 275
            ..   :|..|..||:   ||..:..|.:..|...|. |.::....:..:::.| :|:..||    
plant   236 GD---IKSFSHELNSKGVRPFPLWKPRRLNNLEDIL-NLIRTKFDKAKEEVNS-DLFAFGGDLLD 295

  Fly   276 --------------------------------------SGAV-------VEPPP----------- 284
                                                  .|.|       .|.||           
plant   296 IYDKNKESHPELLVTIEDLLVLAKTCAKTTSKEFWLQCEGIVQDLDDRRQELPPGVLKQLHTRML 360

  Fly   285 -----------------------PYLIQGGAGGAAPPPPPP--------SYTASM----QSRQSP 314
                                   ..|.|.|...:|....|.        |.||:.    .::::.
plant   361 FILTRCTRLLQFHKESWGQEEDAVQLRQSGVLHSADKRDPTGEVRDGKGSSTANALKVPSTKKAY 425

  Fly   315 TQSQQS-------DYRKSPSSGIYSATSAGSPSPITVSLP------PAPLAKPQPRVYQARSQQP 366
            :|.|:.       ..|.:|.|..|:.||..|.||..:...      |:|.:|.......::.|..
plant   426 SQEQRGLNWIEGFFVRPAPLSSPYNETSKDSESPANIDKMSSWKRLPSPASKGVQEAAVSKEQND 490

  Fly   367 IIMQSVKSTQVQK--------------PVLQTAVAPQSPSSASASNSPVHVLAAPPSYPQKSAAV 417
               :.|:..||.|              |.:.:|.|.|...|.:..|.............::|:.:
plant   491 ---RKVEPPQVVKKLVAISDDMAVAKLPEVSSAKASQEHMSKNRHNISWGYWGHQSCISEESSII 552

  Fly   418 VQQQQQAAAAAHQQQH--------QHQQSKPPTPTTPPLVGLNSKPNCLEPPSYAKSMQAKAATV 474
            .:..::.....|.:.|        ::.|..         ||::.:            :.|.|.|:
plant   553 CRICEEEIPTTHVEDHSRICALADKYDQKG---------VGVDER------------LMAVAVTL 596

  Fly   475 VQQQQQQQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLANGN 539
                       :::....:|:......:..:.:::..|....|.|                    
plant   597 -----------EKITDNVIQKDSLAAVESPEGMKISNASLTEELD-------------------- 630

  Fly   540 PGRQMLPPPPYQSNNNNNSEIKP--PSCNNNNIQISNSNLATTPPIP-PAKYNNNSSNTGANSSG 601
                :|.|.....:...:.::..  |..:|:   :...::...|.:. ..::...|....|.||.
plant   631 ----VLSPKLSDWSRRGSEDMLDCFPETDNS---VFMDDMGCLPSMSCRTRFGPKSDQGMATSSA 688

  Fly   602 GSNGSTGTTASSSTSCKKIKHASPIPERKKISKEKEEERK-EFRIRQYSPQAFKF---------- 655
            ||                :...||||..:....|...|.| .|..:...||..:.          
plant   689 GS----------------MTPRSPIPTPRPDPIELLLEGKGTFHDQDDFPQMSELADIARCAANA 737

  Fly   656 --FMEQHIE--------------------NVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKM 698
              ..:|.|:                    .:::::..|..:..| ||.:....|.|.   |...:
plant   738 IPVDDQSIQLLLSCLEDLRVVIDRRKFDALIVETFGTRIEKLIQ-EKYLQLCELMDD---EKGTI 798

  Fly   699 LNQK---ESNYIRLKRA-------KMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRK 753
            :::.   |.:.:|..|.       ::....|..:|.|..||||.|.|..| :|:..|:|:|.|||
plant   799 IDEDAPLEDDVVRSLRTSPVHLRDRISIDDFEVMKSISRGAFGHVILARK-NTTGDLFAIKVLRK 862

  Fly   754 ADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEE 818
            ||::::|.|..:.||||||..|.|.:||:.:|||...:|||.||:|:.|||..|:|.|:|..:|.
plant   863 ADMIRKNAVESILAERDILINARNPFVVRFFYSFTCSENLYLVMEYLNGGDFYSMLRKIGCLDEA 927

  Fly   819 LARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNH 883
            .||.|||||..|::.:|..|.:|||:||||:||..|||:|||||||         ||....|   
plant   928 NARVYIAEVVLALEYLHSEGVVHRDLKPDNLLIAHDGHVKLTDFGL---------SKVGLIN--- 980

  Fly   884 SRQDSMEPWEEYS----ENGPK-PTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCD 943
            :..|...|....:    |..|| ||:       ||:|    |.||||:|:|||:|..:|:....|
plant   981 NTDDLSGPVSSATSLLVEEKPKLPTL-------DHKR----SAVGTPDYLAPEILLGTGHGATAD 1034

  Fly   944 YWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAE-LSREATDLIRRLCA-SADKR 1006
            :||||:||||.|||.|||.|:.|.:....::|  :.:..||..| :|.||.|||.||.. ...:|
plant  1035 WWSVGIILYEFLVGIPPFNADHPQQIFDNILN--RNIQWPPVPEDMSHEARDLIDRLLTEDPHQR 1097

  Fly  1007 LG-KSVDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGD--- 1067
            || :...|||.|.|||.||:..:.:|||.::|:.::..|||.|        :|..|...||:   
plant  1098 LGARGAAEVKQHSFFKDIDWNTLAQQKAAFVPDSENAFDTSYF--------QSRYSWNYSGERCF 1154

  Fly  1068 DVDQNDRTFHG 1078
            ..::|:.:..|
plant  1155 PTNENEDSSEG 1165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 155/372 (42%)
S_TKc 719..1020 CDD:214567 138/309 (45%)
AT1G48490NP_001323023.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 277 1.000 Inparanoid score I868
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.