DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and AT4G33080

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_195034.2 Gene:AT4G33080 AraportID:AT4G33080 Length:519 Species:Arabidopsis thaliana

Alignment Length:459 Identity:188/460 (41%)
Similarity:276/460 (60%) Gaps:39/460 (8%)


  Fly   652 AFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDK 716
            |.|.::|.|.:...|:.::|..|:..||:::...|:|.:.||.|.|.|.:||:.::||||.|:..
plant    27 AAKQYIENHYKAQNKNIQERKERRWILERKLASSGVPKEEQINMIKDLERKETEFMRLKRNKISV 91

  Fly   717 SMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVV 781
            ..|..|..||.||||||.|..:..:.| :||||.|:|::::.|.||.||:|||::|||.:::::|
plant    92 DDFELLTIIGRGAFGEVRLCRERKSGN-IYAMKKLKKSEMVMRGQVEHVRAERNLLAEVESHYIV 155

  Fly   782 KLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKP 846
            ||||||||.:.||.:|:|:||||:|:||::.....|::||||||:...|::|:|:..:|||||||
plant   156 KLYYSFQDPEYLYLIMEYLPGGDMMTLLMREDTLREDVARFYIAQSVLAIESIHRYNYIHRDIKP 220

  Fly   847 DNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEP---------------WEEYS 896
            ||:|:|:|||:||:|||||.... ..|....|||.....:...||               |....
plant   221 DNLLLDKDGHMKLSDFGLCKPLD-CRNLPSIQENRATDDETMSEPMDVDRCFPDTDNKRSWRSPQ 284

  Fly   897 ENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPF 961
            |.      |:..:|  ::|.||.|.||||:|||||||.:.||...||:||:|.|:||||||.|||
plant   285 EQ------LQHWQM--NRRKLAFSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPF 341

  Fly   962 LANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGK--SVDEVKSHDFFKGID 1024
            .|:.|:.|.:|:::|...|..|..|:.|.||.|||.||..:.|.|||.  ...::|.|.:||.:.
plant   342 YADDPISTCRKIVHWRNHLKFPEDAKFSSEAKDLICRLLCNVDHRLGTGGGAQQIKDHPWFKDVV 406

  Fly  1025 FADMRKQKAPYIPEIKHPTDTSNFDPVD------PEKLRSNDSTMSSGDDVDQNDRTFHGFFEFT 1083
            :..:.:.:|.|.||:....||.||...|      ||:.||.   :|....:...|.:|.|   :|
plant   407 WEKLYEMEAAYKPEVNDELDTQNFMKFDEVNSPAPERTRSG---LSRKMLLAPKDLSFVG---YT 465

  Fly  1084 FRRF 1087
            ::.|
plant   466 YKNF 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 162/384 (42%)
S_TKc 719..1020 CDD:214567 144/318 (45%)
AT4G33080NP_195034.2 STKc_NDR_like 92..467 CDD:270750 164/391 (42%)
S_TKc 94..402 CDD:214567 144/318 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126822
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.