DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and AT4G14350

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001329677.1 Gene:AT4G14350 AraportID:AT4G14350 Length:551 Species:Arabidopsis thaliana

Alignment Length:530 Identity:201/531 (38%)
Similarity:298/531 (56%) Gaps:76/531 (14%)


  Fly   610 TASSSTSCKKIKHASPIPERKKISKEKEE-------------ERKEFRIRQYSPQAFKFFMEQHI 661
            ||.:..|..|.|      ::.|.||:||.             |.....|.:....|.|.::|.|.
plant     3 TAKAWLSKLKSK------DKVKSSKKKEATSNVKEGPKTAGGEEALSNITKEKAAAAKLYIENHY 61

  Fly   662 ENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIG 726
            :..::|.::|..|:..|||::....:.::.|..:.|.|..||:.|:|.:|.||....|..|..||
plant    62 KMQMQSLQERKERRKMLEKKLAAAEVSEEEQNNLLKDLEMKETEYMRRQRHKMGADDFEPLTMIG 126

  Fly   727 VGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKD 791
            .||||||.:..:..|.| :||||.|:|:::|:|.||.||||||::|||.|:|.:||||.||||::
plant   127 KGAFGEVRICREKGTGN-VYAMKKLKKSEMLRRGQVEHVKAERNLLAEVDSNCIVKLYCSFQDEE 190

  Fly   792 NLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGH 856
            .||.:|:|:||||:|:||::.....|:.|||||.|...|::|:||..:|||||||||:|:|:|||
plant   191 YLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYIGETVLAIESIHKHNYIHRDIKPDNLLLDKDGH 255

  Fly   857 IKLTDFGLC----------TGFRWTHN-SKYYQENG-----NHSRQDSMEPWEEYSENGPKPTVL 905
            :||:|||||          ..|....| |...|.:|     ..::|:.:..|:.           
plant   256 MKLSDFGLCKPLDCSNLQEKDFTVARNVSGALQSDGRPVATRRTQQEQLLNWQR----------- 309

  Fly   906 ERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQ 970
                   ::|:||:|.||||:|||||||.:.||...||:||:|.|:||||||.|||.::.|:.|.
plant   310 -------NRRMLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGFPPFYSDDPMTTC 367

  Fly   971 QKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLG-KSVDEVKSHDFFKGIDFADMRKQKAP 1034
            :|::||...|..|.:..||.||.|||.||..:.::||| |..||:|.|.:|:|.::..:.:.||.
plant   368 RKIVNWRNYLKFPDEVRLSPEAKDLICRLLCNVEQRLGTKGADEIKGHPWFRGTEWGKLYQMKAA 432

  Fly  1035 YIPEIKHPTDTSNFDPVD------PEKLRSND-STMSSGDDVDQNDRTFHGFFEFTFRRFFDDKQ 1092
            :||::....||.||:..:      |:..:|.. ..|.|..|::        |..:|:      |.
plant   433 FIPQVNDELDTQNFEKFEETDKQVPKSAKSGPWRKMLSSKDIN--------FVGYTY------KN 483

  Fly  1093 PPDMTDDQAP 1102
            ...:.|||.|
plant   484 VEIVNDDQIP 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 162/385 (42%)
S_TKc 719..1020 CDD:214567 147/318 (46%)
AT4G14350NP_001329677.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126822
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.