DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and AT2G19400

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_565453.1 Gene:AT2G19400 AraportID:AT2G19400 Length:527 Species:Arabidopsis thaliana

Alignment Length:484 Identity:182/485 (38%)
Similarity:280/485 (58%) Gaps:42/485 (9%)


  Fly   631 KISKEKEEERKEFRIRQYSP----QAFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQT 691
            |::.|.|:..::..:...|.    .|.|.::|.|....::..:||..|:..||:::..:.:.::.
plant    13 KVTSEVEDNFEDEGLVSNSTLEKVAAAKKYIENHYNRRMRHIQQRKERRWVLEQKIASLDVSEKE 77

  Fly   692 QIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADV 756
            |:|:.:.|.:||:.|.||.|.::....|..|..||.||||||.|..:..|.| :||||.|:|:::
plant    78 QLELLEDLQRKETEYTRLMRNRLCVDDFDLLSIIGRGAFGEVRLCREKKTGN-IYAMKKLKKSEM 141

  Fly   757 LKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELAR 821
            |.|.||.||:|||::|||..::.:|||||||||.:.||.:|:|:.|||:|:||::.....|.:||
plant   142 LSRGQVEHVRAERNLLAEVASDCIVKLYYSFQDPEYLYLIMEYLSGGDVMTLLMREETLTETVAR 206

  Fly   822 FYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQ 886
            ||||:...|::|:||..::||||||||:|:|:.||:||:|||||...          :..|.|..
plant   207 FYIAQSVLAIESIHKHNYVHRDIKPDNLLLDKYGHMKLSDFGLCKPL----------DCRNISAM 261

  Fly   887 DSMEPWEEYSEN----GPKPTVLERRRMR--------DH----QRVLAHSLVGTPNYIAPEVLER 935
            :..||..:.:.|    |.:...:.||..|        .|    :|.||:|.||||:|||||||.:
plant   262 NVNEPLNDENINESIDGDENCSIGRRGRRWKSPLEQLQHWQINRRKLAYSTVGTPDYIAPEVLLK 326

  Fly   936 SGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLC 1000
            .||...||:||:|.|:||||||.|||.::.|:.|.:|:::|...|..|..|.|:.||.|||.||.
plant   327 KGYGVECDWWSLGAIMYEMLVGYPPFYSDDPVTTCRKIVSWRTHLVFPEGARLTPEARDLICRLL 391

  Fly  1001 ASADKRLGK---SVDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSN---FDPVD-PEKLRS 1058
            ..::.|||.   ..:::|:|.:||.:::..:.:..|.:.|.:....||.|   ||.|: |:..|:
plant   392 CDSEHRLGSHGAGAEQIKAHTWFKDVEWEKLYEMDAAFKPVVNGELDTQNFMKFDEVECPKPART 456

  Fly  1059 NDSTMSSGDDVDQNDRTFHGFFEFTFRRF 1087
            ............||    ..|..:|:|.|
plant   457 GSGPSWKVSITPQN----INFVGYTYRNF 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 156/384 (41%)
S_TKc 719..1020 CDD:214567 142/320 (44%)
AT2G19400NP_565453.1 STKc_NDR_like 103..479 CDD:270750 158/391 (40%)
S_TKc 105..414 CDD:214567 142/320 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126822
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.