DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and Stk38l

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001076805.1 Gene:Stk38l RGDID:1564793 Length:464 Species:Rattus norvegicus

Alignment Length:447 Identity:198/448 (44%)
Similarity:286/448 (64%) Gaps:38/448 (8%)


  Fly   654 KFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSM 718
            |..:|....|:|..:.:|..|:.:||..|.:.||.|:.:...|....:||:.::||||.::....
  Rat    25 KLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDD 89

  Fly   719 FVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKL 783
            |..||.||.||||||.||.|.|| .|:||||.|||||:|::.||||::||||||.|||..||||:
  Rat    90 FESLKVIGRGAFGEVRLVQKKDT-GHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKM 153

  Fly   784 YYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDN 848
            :||||||.|||.:|:::||||:|:||:|.....||..:|||:|...|:|::|::|||||||||||
  Rat   154 FYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDN 218

  Fly   849 ILIDRDGHIKLTDFGLCTGFRWTHNSKYYQ------------ENGNHSRQDSMEPWEEYSENGPK 901
            :|:|..||:||:|||||||.:..|.:::|:            :|.|..|:  .|.|::       
  Rat   219 LLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRK--AETWKK------- 274

  Fly   902 PTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSP 966
                       ::|.||:|.||||:||||||..::||.:|||:||:|||:||||:|.|||.:.:|
  Rat   275 -----------NRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGFPPFCSETP 328

  Fly   967 LETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGK-SVDEVKSHDFFKGIDFADMRK 1030
            .||.:||::|::||..||:..:|.:|.|||.|.|..::.|:|. .|:|:|.|.||:|:|:..:|:
  Rat   329 QETYRKVMSWKETLAFPPEVPVSEKAKDLILRFCTDSENRIGNGGVEEIKGHPFFEGVDWGHIRE 393

  Fly  1031 QKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDVDQNDRTFHGFFEFTFRRF 1087
            :.|....||:...||||||.. ||.........::..|....|..   |..:|::||
  Rat   394 RPAAIPIEIRSIDDTSNFDDF-PESDILQPVPNTTEPDYKSKDWV---FLNYTYKRF 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 175/374 (47%)
S_TKc 719..1020 CDD:214567 158/314 (50%)
Stk38lNP_001076805.1 STKc_NDR2 87..452 CDD:270776 179/386 (46%)
S_TKc 90..383 CDD:214567 158/314 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.